Hydrogen Potassium ATPase Beta Antibody - BSA Free

Western Blot: Hydrogen Potassium ATPase Beta Antibody [NBP1-91573] - Rat Lung lysate, concentration 0.2-1 ug/ml.

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Hydrogen Potassium ATPase Beta Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP4B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Hydrogen Potassium ATPase Beta Antibody - BSA Free

• ATP4B
• ATP6B
• ATPase, H+/K+ exchanging, beta polypeptide
• ATPase, H+/K+ transporting, beta polypeptide
• Gastric H(+)/K(+) ATPase subunit beta
• gastric H+/K+ ATPase beta subunit
• gastric hydrogen-potassium ATPase, beta
• Hydrogen Potassium ATPase Beta
• potassium-transporting ATPase beta chain
• potassium-transporting ATPase subunit beta
• Proton pump beta chain

Background

The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P-type cation-transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha-subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta-subunit which may play a role in maintaining the structural and functional integrity of the complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hydrogen Potassium ATPase Beta Antibody (NBP1-91573)(1)

Publication using NBP1-91573

• Xu Z, Chen J, Cai J et al. Mitochondrial ATP synthase regulates corpus cavernosum smooth muscle cell function in vivo and in vitro Experimental and Therapeutic Medicine 2020-04-02 [PMID: 32346410] (Western Blot)

Bioinformatics

• Gene Symbol: ATP4B
• Uniprot:
  • NP_036642(Rat)