Hyaluronan Synthase 3/HAS3 Antibody

Images

 
Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [NBP1-62551] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hyaluronan Synthase 3/HAS3 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human HAS3 (NP_005320). Peptide sequence GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HAS3 and was validated on Western blot.
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Hyaluronan Synthase 3/HAS3 Antibody

  • EC 2.4.1.212
  • HA synthase 3
  • HAS3
  • Hyaluronan Synthase 3
  • Hyaluronate synthase 3
  • Hyaluronic acid synthase 3

Background

HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83409
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-62551
Species: Hu
Applications: WB

Publications for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551) (0)

There are no publications for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551) (0)

There are no reviews for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hyaluronan Synthase 3/HAS3 Products

Bioinformatics Tool for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551)

Discover related pathways, diseases and genes to Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551)

Discover more about diseases related to Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551).
 

Pathways for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551)

View related products by pathway.

PTMs for Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551)

Learn more about PTMs related to Hyaluronan Synthase 3/HAS3 Antibody (NBP1-62551).

Blogs on Hyaluronan Synthase 3/HAS3

There are no specific blogs for Hyaluronan Synthase 3/HAS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hyaluronan Synthase 3/HAS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAS3
Entrez
Uniprot