Recombinant Human HUNK Protein

Images

 
SDS-Page: Recombinant Human HUNK Protein [H00030811-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HUNK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 615-714 of Human HUNK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HUNK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HUNK Protein

  • B19
  • EC 2.7.11
  • EC 2.7.11.1
  • hormonally up-regulated neu tumor-associated kinase
  • hormonally upregulated neu tumor-associated kinase
  • hormonally up-regulated Neu-associated kinase
  • hormonally upregulated Neu-associated kinase
  • MAKV
  • serine/threonine protein kinase MAK-V
  • Serine/threonine-protein kinase MAK-V

Background

HUNK - hormonally upregulated Neu-associated kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24567
Species: Hu
Applications: WB
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HUNK Partial Recombinant Protein (H00030811-Q01) (0)

There are no publications for HUNK Partial Recombinant Protein (H00030811-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HUNK Partial Recombinant Protein (H00030811-Q01) (0)

There are no reviews for HUNK Partial Recombinant Protein (H00030811-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HUNK Partial Recombinant Protein (H00030811-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HUNK Products

Bioinformatics Tool for HUNK Partial Recombinant Protein (H00030811-Q01)

Discover related pathways, diseases and genes to HUNK Partial Recombinant Protein (H00030811-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HUNK Partial Recombinant Protein (H00030811-Q01)

Discover more about diseases related to HUNK Partial Recombinant Protein (H00030811-Q01).
 

Pathways for HUNK Partial Recombinant Protein (H00030811-Q01)

View related products by pathway.

PTMs for HUNK Partial Recombinant Protein (H00030811-Q01)

Learn more about PTMs related to HUNK Partial Recombinant Protein (H00030811-Q01).
 

Research Areas for HUNK Partial Recombinant Protein (H00030811-Q01)

Find related products by research area.

Blogs on HUNK

There are no specific blogs for HUNK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HUNK Antibody
NBP2-14110

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HUNK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HUNK