HUCE1 Recombinant Protein Antigen

Images

 
There are currently no images for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HUCE1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HUCE1.

Source: E.coli

Amino Acid Sequence: AWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQAPAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RRP8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55730 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HUCE1 Recombinant Protein Antigen

  • Cerebral protein 1
  • KIAA0409EC 2.1.1.-
  • NML
  • nucleomethylin
  • ribosomal RNA processing 8, methyltransferase, homolog (yeast)
  • ribosomal RNA-processing protein 8
  • RRP8 methyltransferase homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NBP1-21367
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
DKK300
Species: Hu
Applications: ELISA
NBP2-71601
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
202-IL
Species: Hu
Applications: BA
NB100-56563
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
NB100-64808
Species: Hu, Mu
Applications: ELISA, Flow, IF, IHC, IHC-Fr, IP, WB
DR2A00
Species: Hu
Applications: ELISA
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-55730PEP
Species: Hu
Applications: AC

Publications for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP) (0)

There are no publications for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP) (0)

There are no reviews for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HUCE1 Products

Bioinformatics Tool for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP)

Discover related pathways, diseases and genes to HUCE1 Recombinant Protein Antigen (NBP2-55730PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP)

View related products by pathway.

PTMs for HUCE1 Recombinant Protein Antigen (NBP2-55730PEP)

Learn more about PTMs related to HUCE1 Recombinant Protein Antigen (NBP2-55730PEP).

Blogs on HUCE1

There are no specific blogs for HUCE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HUCE1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RRP8