HSPA8/HSC71/Hsc70 Antibody

Product Discontinued

HSPA8/HSC71/Hsc70 Antibody Summary

• Immunogen: Synthetic peptides corresponding to HSPA8(heat shock 70kDa protein 8) The peptide sequence was selected from the N terminal of HSPA8 (NP_006588). Peptide sequence MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL.
• Predicted Species: Porcine (100%), Bovine (100%), Zebrafish (100%), Goat (100%), Sheep (100%). Backed by our 100% Guarantee.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSPA8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:400
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:1000
• Application Notes: This is a rabbit polyclonal antibody against HSPA8 and was validated on Western blot. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 23785054)
• Theoretical MW: 71 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: LYOPH
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSPA8/HSC71/Hsc70 Antibody

• Heat shock 70 kDa protein 8
• heat shock 70kD protein 8
• heat shock 70kDa protein 8
• heat shock cognate 71 kDa protein
• heat shock cognate protein 54
• heat shock cognate protein, 71-kDa
• HSC54
• HSC70
• HSC70heat shock 70kd protein 10
• HSC71
• HSP71
• HSP73
• HSP73constitutive heat shock protein 70
• HSPA10
• HSPA8
• LAP1
• lipopolysaccharide-associated protein 1
• LPS-associated protein 1
• MGC131511
• MGC29929
• NIP71
• N-myristoyltransferase inhibitor protein 71

Background

HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HSPA8/HSC71/Hsc70 Antibody (NBP1-55105)(1)

Publication using NBP1-55105

• Groth Casper, Sasamura Takeshi, Khanna Mansi R et al. Protein trafficking abnormalities in Drosophila tissues with impaired activity of the ZIP7 zinc transporter Catsup. Development. 2013-07-01 [PMID: 23785054] (ICC/IF, IF/IHC, Drosophila)

Bioinformatics

• Gene Symbol: HSPA8
• Entrez:
  • 3312(Human)
• Uniprot:
  • P11142(Human)