Hsp47 Antibody (3K3H1)

Western Blot: Hsp47 Antibody (3K3H1) [NBP3-15430] - Western blot analysis of extracts of various cell lines, using Hsp47 Rabbit mAb (NBP3-15430) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: Hsp47 Antibody (3K3H1) [NBP3-15430] - Immunofluorescence analysis of NIH-3T3 cells using Hsp47 Rabbit mAb (NBP3-15430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Hsp47 Antibody (3K3H1) [NBP3-15430] - Immunohistochemistry of paraffin-embedded human colon using Hsp47 Rabbit mAb (NBP3-15430) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Hsp47 Antibody (3K3H1) [Hsp47] - Confocal imaging of NIH/3T3 cells using Hsp47 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: Hsp47 Antibody (3K3H1) [Hsp47] - Confocal imaging of U-2 OS cells using Hsp47 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clone: 3K3H1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Hsp47 Antibody (3K3H1) Summary

• Description: Novus Biologicals Rabbit Hsp47 Antibody (3K3H1) (NBP3-15430) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 319-418 of human Hsp47 (P50454). KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SERPINH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Hsp47 Antibody (3K3H1)

• (collagen binding protein 1)
• Arsenic-transactivated protein 3
• AsTP3
• BERF-1
• CBP1
• CBP2
• CBP2RA-A47
• Cell proliferation-inducing gene 14 protein
• Collagen-binding protein
• colligen
• Colligin
• colligin-1
• colligin-2
• gp46
• HSP47
• HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
• member 1, (collagen binding protein 1)
• member 2
• member 2, (collagen-binding protein 2)
• OI10
• PPROM
• proliferation-inducing gene 14
• RA-A47
• rheumatoid arthritis antigen A-47,47 kDa heat shock protein
• Rheumatoid arthritis-related antigen RA-A47
• serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
• Serpin H1
• serpin peptidase inhibitor, clade H (heat shock protein 47), member 1
• SERPINH1
• SERPINH2colligin

Background

Hsp47 encodes a member of the serpin superfamily of serine proteinase inhibitors. Its expression is induced by heat shock. The protein localizes to the endoplasmic reticulum lumen and binds collagen; thus it is thought to be a molecular chaperone involved in the maturation of collagen molecules. Autoantibodies to this protein have been found in patients with rheumatoid arthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINH1