Hsp40/DNAJC25 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Hsp40/DNAJC25 Antibody [NBP1-90037] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Hsp40/DNAJC25 Antibody [NBP1-90037] - Staining of human liver shows strong cytoplasmic positivity in liver.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hsp40/DNAJC25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Hsp40/DNAJC25 Protein (NBP1-90037PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hsp40/DNAJC25 Antibody

  • bA16L21.2.1
  • DNAJC25 DnaJ (Hsp40) homolog, subfamily C, member 25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB7185
Species: Hu
Applications: WB, Simple Western
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-85002
Species: Hu
Applications: WB, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-15597
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-56693
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-90037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Hsp40/DNAJC25 Antibody (NBP1-90037) (0)

There are no publications for Hsp40/DNAJC25 Antibody (NBP1-90037).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp40/DNAJC25 Antibody (NBP1-90037) (0)

There are no reviews for Hsp40/DNAJC25 Antibody (NBP1-90037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Hsp40/DNAJC25 Antibody (NBP1-90037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hsp40/DNAJC25 Products

Bioinformatics Tool for Hsp40/DNAJC25 Antibody (NBP1-90037)

Discover related pathways, diseases and genes to Hsp40/DNAJC25 Antibody (NBP1-90037). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Hsp40/DNAJC25

There are no specific blogs for Hsp40/DNAJC25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hsp40/DNAJC25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC25