HSP20/HSPB6 Antibody

Images

 
Western Blot: HSP20/HSPB6 Antibody [NBP2-32027] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Skeletal muscle tissue
Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027] - Staining in human skeletal muscle and tonsil tissues using anti-HSPB6 antibody. Corresponding HSPB6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: HSP20/HSPB6 Antibody [NBP2-32027] - Staining of human tonsil shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSP20/HSPB6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVK
Specificity
Specificity of human, human (negative) HSP20/HSPB6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPB6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSP20/HSPB6 Protein (NBP2-32027PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSP20/HSPB6 Antibody

  • FLJ32389
  • Heat shock 20 kDa-like protein p20
  • heat shock protein beta-6
  • heat shock protein, alpha-crystallin-related, B6
  • HSP20
  • HSPB6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NB100-2519
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2584
Species: Mu
Applications: WB, Simple Western
NBP1-84334
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-07644
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO

Publications for HSP20/HSPB6 Antibody (NBP2-32027) (0)

There are no publications for HSP20/HSPB6 Antibody (NBP2-32027).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP20/HSPB6 Antibody (NBP2-32027) (0)

There are no reviews for HSP20/HSPB6 Antibody (NBP2-32027). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSP20/HSPB6 Antibody (NBP2-32027) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSP20/HSPB6 Products

Bioinformatics Tool for HSP20/HSPB6 Antibody (NBP2-32027)

Discover related pathways, diseases and genes to HSP20/HSPB6 Antibody (NBP2-32027). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP20/HSPB6 Antibody (NBP2-32027)

Discover more about diseases related to HSP20/HSPB6 Antibody (NBP2-32027).
 

Pathways for HSP20/HSPB6 Antibody (NBP2-32027)

View related products by pathway.

PTMs for HSP20/HSPB6 Antibody (NBP2-32027)

Learn more about PTMs related to HSP20/HSPB6 Antibody (NBP2-32027).

Blogs on HSP20/HSPB6

There are no specific blogs for HSP20/HSPB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSP20/HSPB6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPB6
Entrez
Uniprot