HSP20/HSPB6 Antibody (3J5N1)

Images

 
Western Blot: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Western blot analysis of extracts of various cell lines, using HSP20/HSPB6 Rabbit mAb (NBP3-16751) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit ...read more
Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded human colon carcinoma tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x ...read more
Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded rat heart tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High ...read more
Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded human lung tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High ...read more
Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded mouse heart tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). ...read more
Immunocytochemistry/ Immunofluorescence: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Confocal imaging of paraffin-embedded Rat heart tissue using HSP20/HSPB6 Rabbit mAb followed by a further incubation with Cy3 Goat ...read more
Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded human liver cancer tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x ...read more
Immunocytochemistry/ Immunofluorescence: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Confocal imaging of paraffin-embedded Mouse heart tissue using HSP20/HSPB6 Rabbit mAb followed by a further incubation with Cy3 Goat ...read more
Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded rat colon tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
3J5N1
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSP20/HSPB6 Antibody (3J5N1) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558). DPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
HSPB6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HSP20/HSPB6 Antibody (3J5N1)

  • FLJ32389
  • Heat shock 20 kDa-like protein p20
  • heat shock protein beta-6
  • heat shock protein, alpha-crystallin-related, B6
  • HSP20
  • HSPB6

Background

Hsp20 is a small heat shock protein related to Hsp25, Hsp27 and may form different hetercomplexes with these proteins. The specific physiological function of Hsp20 is not yet known. It is distributed ubiquitously in tissues, but is found in higher levels in skeletal, smooth and heart muscle. Under normal conditions, Hsp20 is diffusely distributed in the cytosol, but under heat stress conditions, it translocates to the nucleus. Unlike other heat shock proteins the amount of Hsp20 does not increase after heat shock. The Hsp20 was demonstrated to constitute up to 1.3% of the total cellular protein in vertebrate tissues, especially in muscle, and its expression is related to muscle contraction, specifically in slow-twitch muscle. Hsp20 may form different heterocomplexes with other Hsp's, such as alpha-crystalline and Hsp25. Phosphorylated form of Hsp20 is proposed to interact with monomeric actin whereas dephosphorylated form binds polymeric actin filaments. In normal conditions Hsp20 is diffusely disturbed in cytosol but under the heat stress it undergoes translocation to membrane fraction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB4987
Species: Hu, Mu, Rt
Applications: WB
NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2584
Species: Mu
Applications: Simple Western, WB
H00027129-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-07644
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP3-17045
Species: Hu
Applications: IHC,  IHC-P
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-16751
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for HSP20/HSPB6 Antibody (NBP3-16751) (0)

There are no publications for HSP20/HSPB6 Antibody (NBP3-16751).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP20/HSPB6 Antibody (NBP3-16751) (0)

There are no reviews for HSP20/HSPB6 Antibody (NBP3-16751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSP20/HSPB6 Antibody (NBP3-16751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSP20/HSPB6 Products

Research Areas for HSP20/HSPB6 Antibody (NBP3-16751)

Find related products by research area.

Blogs on HSP20/HSPB6

There are no specific blogs for HSP20/HSPB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSP20/HSPB6 Antibody (3J5N1) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPB6