HSF4 Antibody (3G3)

Images

 
Western Blot: HSF4 Antibody (3G3) [H00003299-M03] - Analysis of HSF4 expression in A-431 (Cat # L015V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSF4 Antibody (3G3) Summary

Immunogen
HSF4 (NP_001529, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
Specificity
HSF4 (3G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSF4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSF4 Antibody (3G3)

  • ATHSF4
  • AT-HSFB1
  • cataract, Marner
  • CTM
  • heat shock factor protein 4
  • heat shock transcription factor 4CTM
  • hHSF4
  • HSF 4
  • HSF4
  • HSFB1
  • HSTF 4

Background

Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBL1-14964
Species: Hu
Applications: WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
NBP1-86644
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF6386
Species: Hu
Applications: IP, WB
NBP1-86641
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-17157
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-76827
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-97475
Species: Ma, Hu, Mu, Pm, Rb, Rt
Applications: ELISA, EIA, GS, IP, WB
NBP2-80457
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32557
Species: Hu, Mu
Applications: WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-92873
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-88263
Species: Hu
Applications: IHC, IHC-P, WB

Publications for HSF4 Antibody (H00003299-M03) (0)

There are no publications for HSF4 Antibody (H00003299-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSF4 Antibody (H00003299-M03) (0)

There are no reviews for HSF4 Antibody (H00003299-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSF4 Antibody (H00003299-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSF4 Products

Bioinformatics Tool for HSF4 Antibody (H00003299-M03)

Discover related pathways, diseases and genes to HSF4 Antibody (H00003299-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSF4 Antibody (H00003299-M03)

Discover more about diseases related to HSF4 Antibody (H00003299-M03).
 

Pathways for HSF4 Antibody (H00003299-M03)

View related products by pathway.

PTMs for HSF4 Antibody (H00003299-M03)

Learn more about PTMs related to HSF4 Antibody (H00003299-M03).

Blogs on HSF4

There are no specific blogs for HSF4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSF4 Antibody (3G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSF4
Entrez
OMIM
Uniprot