Recombinant Human HSD17B3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HSD17B3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 310 of Human HSD17B3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HSD17B3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
60.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HSD17B3 Protein

  • EC 1.1.1.64
  • EDH17B317-beta-HSD3
  • hydroxysteroid (17-beta) dehydrogenase 3,17-beta-hydroxysteroid dehydrogenase type 3
  • SDR12C2
  • short chain dehydrogenase/reductase family 12C, member 2
  • Testicular 17-beta-hydroxysteroid dehydrogenase
  • testosterone 17-beta-dehydrogenase 3,17-beta-HSD 3

Background

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7178
Species: Hu
Applications: WB, IHC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81567
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13891
Species: Hu
Applications: IHC, IHC-P
H00003293-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HSD17B3 Recombinant Protein (H00003293-P01) (0)

There are no publications for HSD17B3 Recombinant Protein (H00003293-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B3 Recombinant Protein (H00003293-P01) (0)

There are no reviews for HSD17B3 Recombinant Protein (H00003293-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B3 Recombinant Protein (H00003293-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HSD17B3 Recombinant Protein (H00003293-P01)

Discover related pathways, diseases and genes to HSD17B3 Recombinant Protein (H00003293-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B3 Recombinant Protein (H00003293-P01)

Discover more about diseases related to HSD17B3 Recombinant Protein (H00003293-P01).
 

Pathways for HSD17B3 Recombinant Protein (H00003293-P01)

View related products by pathway.

PTMs for HSD17B3 Recombinant Protein (H00003293-P01)

Learn more about PTMs related to HSD17B3 Recombinant Protein (H00003293-P01).
 

Research Areas for HSD17B3 Recombinant Protein (H00003293-P01)

Find related products by research area.

Blogs on HSD17B3

There are no specific blogs for HSD17B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HSD17B3 Antibody
NBP2-38807

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HSD17B3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B3