Recombinant Human HSD17B2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HSD17B2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 243 - 342 of Human HSD17B2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HSD17B2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HSD17B2 Protein

  • 17-beta-hydroxysteroid dehydrogenase type 2
  • 20 alpha-hydroxysteroid dehydrogenase
  • E2DH
  • EC 1.1.1.62,17-beta-HSD 2
  • EC 1.1.1.63
  • EDH17B220-alpha-HSD
  • estradiol 17-beta-dehydrogenase 2
  • HSD17
  • hydroxysteroid (17-beta) dehydrogenase 2
  • Microsomal 17-beta-hydroxysteroid dehydrogenase
  • SDR9C2
  • short chain dehydrogenase/reductase family 9C, member 2
  • Testosterone 17-beta-dehydrogenase

Background

HSD17B2 - hydroxysteroid (17-beta) dehydrogenase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6529
Species: Hu
Applications: WB, Simple Western
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7178
Species: Hu
Applications: WB, Simple Western
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00003294-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HSD17B2 Partial Recombinant Protein (H00003294-Q01) (0)

There are no publications for HSD17B2 Partial Recombinant Protein (H00003294-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B2 Partial Recombinant Protein (H00003294-Q01) (0)

There are no reviews for HSD17B2 Partial Recombinant Protein (H00003294-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B2 Partial Recombinant Protein (H00003294-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSD17B2 Products

Bioinformatics Tool for HSD17B2 Partial Recombinant Protein (H00003294-Q01)

Discover related pathways, diseases and genes to HSD17B2 Partial Recombinant Protein (H00003294-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B2 Partial Recombinant Protein (H00003294-Q01)

Discover more about diseases related to HSD17B2 Partial Recombinant Protein (H00003294-Q01).
 

Pathways for HSD17B2 Partial Recombinant Protein (H00003294-Q01)

View related products by pathway.

PTMs for HSD17B2 Partial Recombinant Protein (H00003294-Q01)

Learn more about PTMs related to HSD17B2 Partial Recombinant Protein (H00003294-Q01).

Blogs on HSD17B2

There are no specific blogs for HSD17B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HSD17B2 Antibody
NBP1-92011

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HSD17B2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B2