HSD11B1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HSD11B1L Antibody [NBP2-55319] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSD11B1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS
Specificity
Specificity of human HSD11B1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD11B1L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HSD11B1L Antibody

  • 11-beta-hydroxysteroid dehydrogenase type 3
  • 11-DH3
  • EC 1.1.1
  • EC 1.1.1.-
  • HSD3,11-beta-HSD3
  • hydroxysteroid (11-beta) dehydrogenase 1-like
  • hydroxysteroid 11-beta-dehydrogenase 1-like protein
  • SCDR10short chain dehydrogenase/reductase 10
  • SDR26C2
  • short chain dehydrogenase/reductase family 26C, member 2
  • Short-chain dehydrogenase/reductase 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB8630
Species: Hu
Applications: WB, IHC
MAB7450
Species: Hu
Applications: IHC
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85368
Species: Hu, RM
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86987
Species: Hu
Applications: WB, ICC/IF
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-38807
Species: Hu
Applications: IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-46587
Species: Hu
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-87240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP1-74112
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, IHC
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSD11B1L Antibody (NBP2-55319) (0)

There are no publications for HSD11B1L Antibody (NBP2-55319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD11B1L Antibody (NBP2-55319) (0)

There are no reviews for HSD11B1L Antibody (NBP2-55319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HSD11B1L Antibody (NBP2-55319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSD11B1L Products

Bioinformatics Tool for HSD11B1L Antibody (NBP2-55319)

Discover related pathways, diseases and genes to HSD11B1L Antibody (NBP2-55319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for HSD11B1L Antibody (NBP2-55319)

Find related products by research area.

Blogs on HSD11B1L

There are no specific blogs for HSD11B1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD11B1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD11B1L