HPDL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HPDL Antibody [NBP1-89365] - staining of human cell line CACO-2 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HPDL Antibody [NBP1-89365] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubule.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPDL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPDL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HPDL Protein (NBP1-89365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPDL Antibody

  • 4-hydroxyphenylpyruvate dioxygenase-like protein
  • 4-hydroxyphenylpyruvate dioxygenase-like
  • EC 1.13
  • GLOXD1,4-HPPD-L
  • glyoxalase domain containing 1
  • Glyoxalase domain-containing protein 1
  • MGC15668
  • RP4-534D1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF1396
Species: Hu
Applications: WB
MAB4726
Species: Hu
Applications: Flow, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89365
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HPDL Antibody (NBP1-89365) (0)

There are no publications for HPDL Antibody (NBP1-89365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPDL Antibody (NBP1-89365) (0)

There are no reviews for HPDL Antibody (NBP1-89365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HPDL Antibody (NBP1-89365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPDL Products

Bioinformatics Tool for HPDL Antibody (NBP1-89365)

Discover related pathways, diseases and genes to HPDL Antibody (NBP1-89365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPDL Antibody (NBP1-89365)

Discover more about diseases related to HPDL Antibody (NBP1-89365).
 

Pathways for HPDL Antibody (NBP1-89365)

View related products by pathway.

PTMs for HPDL Antibody (NBP1-89365)

Learn more about PTMs related to HPDL Antibody (NBP1-89365).

Blogs on HPDL

There are no specific blogs for HPDL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPDL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPDL