HOXD11 Antibody (5G4)

Images

 
Western Blot: HOXD11 Antibody (5G4) [H00003237-M03] - Analysis of HOXD11 expression in K-562 (Cat # L009V1).
Immunocytochemistry/ Immunofluorescence: HOXD11 Antibody (5G4) [H00003237-M03] - Analysis of monoclonal antibody to HOXD11 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: HOXD11 Antibody (5G4) [H00003237-M03] - Detection limit for recombinant GST tagged HOXD11 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXD11 Antibody (5G4) Summary

Immunogen
HOXD11 (NP_067015, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR
Specificity
HOXD11 - homeobox D11
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXD11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXD11 Antibody (5G4)

  • homeo box D11
  • homeobox D11
  • Homeobox protein Hox-4F
  • homeobox protein Hox-D11
  • HOX4
  • Hox-4.6, mouse, homolog of
  • HOX4Fhomeo box 4F

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52149
Species: Hu
Applications: ICC/IF, IHC, IHC-P, MiAr, PEP-ELISA
NBP1-80228
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-17383
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-85074
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
1845-SH/CF
Species: Hu
Applications: BA
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-32356
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-85076
Species: Hu
Applications: WB
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
7460-F4/CF
Species: Hu
Applications: BA
NBP2-56195
Species: Hu
Applications: ICC/IF, WB
H00003222-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
H00003229-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00003237-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HOXD11 Antibody (H00003237-M03) (0)

There are no publications for HOXD11 Antibody (H00003237-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD11 Antibody (H00003237-M03) (0)

There are no reviews for HOXD11 Antibody (H00003237-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXD11 Antibody (H00003237-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXD11 Products

Bioinformatics Tool for HOXD11 Antibody (H00003237-M03)

Discover related pathways, diseases and genes to HOXD11 Antibody (H00003237-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD11 Antibody (H00003237-M03)

Discover more about diseases related to HOXD11 Antibody (H00003237-M03).
 

Pathways for HOXD11 Antibody (H00003237-M03)

View related products by pathway.

PTMs for HOXD11 Antibody (H00003237-M03)

Learn more about PTMs related to HOXD11 Antibody (H00003237-M03).

Blogs on HOXD11

There are no specific blogs for HOXD11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD11 Antibody (5G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD11
Entrez
OMIM
Uniprot