Home » HOXC8 » HOXC8 Antibodies » HOXC8 Antibody (5G1)

HOXC8 Antibody (5G1)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: HOXC8 Antibody (5G1) [H00003224-M01] - Detection limit for recombinant GST tagged HOXC8 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: HOXC8 Antibody (5G1) [H00003224-M01] - Detection limit for recombinant GST tagged HOXC8 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-Fr, S-ELISA
Clone
5G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HOXC8 Antibody (5G1) Summary

Immunogen
HOXC8 (NP_073149, 47 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Specificity
HOXC8 - homeo box C8
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00003224-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC8 Antibody (5G1)

  • homeo box C8
  • homeobox C8
  • Homeobox protein Hox-3A
  • homeobox protein Hox-C8
  • HOX3
  • Hox-3.1, mouse, homolog of
  • HOX3Ahomeo box 3A

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HOXC6 Antibody
NBP2-23804
HOXC6 Antibody
Species: Hu, Mu, Rt, Bv, Ca, Pm, Sh
Applications: PEP-ELISA
Osteopontin/OPN
Antibody [Unconjugate
AF808
Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN was detected in perfusion fixed frozen sections of mouse thymus using Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(7 Reviews)
(81 Publications)
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
HOXA7 Antibody
(2F2)
H00003204-M01
Western Blot: HOXA7 Antibody (2F2) [H00003204-M01] - Analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.Lane 1: HOXA7 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: HOXA7 Antibody (2F2) [H00003204-M01] - Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, S-ELISA
HOXD4 Antibody
(OTI1E9)
NBP2-46001
Western Blot: HOXD4 Antibody (OTI1E9) [NBP2-46001] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HOXD4 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HOXD4.
Immunohistochemistry-Paraffin: HOXD4 Antibody (OTI1E9) [NBP2-46001] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-HOXD4 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
GTF2IRD1 Antibody
NBP1-91973
Western Blot: GTF2IRD1 Antibody [NBP1-91973] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: GTF2IRD1 Antibody [NBP1-91973] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GTF2IRD1 Antibody [NBP1-91973] - Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, KO
HOXD8 Antibody
NBP2-27108
Western Blot: HOXD8 Antibody [NBP2-27108] - Analysis of HOXD8 in T98G cell lysate in the 1) pre-bleed at 1:5000 dilution 2) T98G cell lysate and 3) NIH 3T3 cell lysate using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu, Mu, Pm
Applications: WB
HOXD10 Antibody
(OTI1D11)
NBP2-45744
Western Blot: HOXD10 Antibody (1D11) [NBP2-45744] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HOXD10.
Immunohistochemistry: HOXD10 Antibody (1D11) [NBP2-45744] - Analysis of Carcinoma of Human bladder tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: HOXD10 Antibody (1D11) [NBP2-45744] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu, Mu, Rt
Applications: WB, IHC
HOXB8 Antibody
NBP2-83058
Western Blot: HOXB8 Antibody [NBP2-83058] - WB Suggested Anti-HOXB8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Liver
Western Blot: HOXB8 Antibody [NBP2-83058] - Host: Rabbit. Target Name: HOXB8. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
HOXA5 Antibody
NBP2-42520
Western Blot: HOXA5 Antibody [NBP2-42520] - Staining of Pig Kidney lysate with antibody at 1 ug/mL (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: HOXA5 Antibody [NBP2-42520] - Staining of paraffin embedded Human Prostate. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
HOXD9 Antibody
NBP2-85076
Western Blot: HOXD9 Antibody [NBP2-85076] - WB Suggested Anti-HOXD9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Spleen
Western Blot: HOXD9 Antibody [NBP2-85076] - Host: Rabbit. Target: HOXD9. Positive control (+): 293T Cell Lysate (2T). Negative control (-): Human Lung (LU). Antibody concentration: 2ug/ml
Species: Hu
Applications: WB
HOXB7 Antibody
NBP2-14098
Immunocytochemistry/Immunofluorescence: HOXB7 Antibody [NBP2-14098] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
HOXA9 Antibody
NBP2-32356
Western Blot: HOXA9 Antibody [NBP2-32356] - Analysis in human cell line HEK 293.
Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
(4 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
HOXC9 Antibody
NBP2-87596
Western Blot: HOXC9 Antibody [NBP2-87596] - WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/ml. Positive Control: Transfected 293T
Immunohistochemistry: HOXC9 Antibody [NBP2-87596] - Human Lung
Western Blot: HOXC9 Antibody [NBP2-87596] - Host: Rabbit. Target Name: HOXC9. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml
Species: Hu
Applications: WB, IHC, IHC-P
HOXA10 Antibody
NBP3-04877
Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of various cell lines, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of Mouse kidney, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit
Species: Hu, Mu, Rt
Applications: WB
HOXD3 Antibody
(1B12)
H00003232-M09
Western Blot: HOXD3 Antibody (1B12) [H00003232-M09] - Analysis of HOXD3 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/Immunofluorescence: HOXD3 Antibody (1B12) [H00003232-M09] - Analysis of monoclonal antibody to HOXD3 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: HOXD3 Antibody (1B12) [H00003232-M09] - Detection limit for recombinant GST tagged HOXD3 is approximately 10ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
HOXD11 Antibody
(6C8)
H00003237-M10
Western Blot: HOXD11 Antibody (6C8) [H00003237-M10] - Analysis of HOXD11 expression in K-562 (Cat # L009V1).
Immunocytochemistry/Immunofluorescence: HOXD11 Antibody (6C8) [H00003237-M10] - Analysis of monoclonal antibody to HOXD11 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: HOXD11 Antibody (6C8) [H00003237-M10] - Analysis of monoclonal antibody to HOXD11 on formalin-fixed paraffin-embedded human colon. Antibody concentration 0.7 ug/ml
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
HOXC5 Antibody
(1E10)
H00003222-M01
Sandwich ELISA: HOXC5 Antibody (1E10) [H00003222-M01] - Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
HOXD1 Antibody
(4F4)
H00003231-M01
Western Blot: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 expression in transfected 293T cell line by HOXD1 monoclonal antibody (M01), clone 4F4.Lane 1: HOXD1 transfected lysate(34.1 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 transfected lysate using anti-HOXD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXD1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA: HOXD1 Antibody (4F4) [H00003231-M01] - Detection limit for recombinant GST tagged HOXD1 is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for HOXC8 Antibody (H00003224-M01)(1)


Reviews for HOXC8 Antibody (H00003224-M01) (0)

There are no reviews for HOXC8 Antibody (H00003224-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC8 Antibody (H00003224-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional HOXC8 Products

Bioinformatics Tool for HOXC8 Antibody (H00003224-M01)

Discover related pathways, diseases and genes to HOXC8 Antibody (H00003224-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC8 Antibody (H00003224-M01)

Discover more about diseases related to HOXC8 Antibody (H00003224-M01).
 

Pathways for HOXC8 Antibody (H00003224-M01)

View related products by pathway.

PTMs for HOXC8 Antibody (H00003224-M01)

Learn more about PTMs related to HOXC8 Antibody (H00003224-M01).

Blogs on HOXC8

There are no specific blogs for HOXC8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC8 Antibody (5G1) and receive a gift card or discount.


Bioinformatics

Gene Symbol HOXC8
Entrez
OMIM
Uniprot