HOXC8 Antibody (5G1)

Images

 
Sandwich ELISA: HOXC8 Antibody (5G1) [H00003224-M01] - Detection limit for recombinant GST tagged HOXC8 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-Fr, S-ELISA
Clone
5G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXC8 Antibody (5G1) Summary

Immunogen
HOXC8 (NP_073149, 47 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Specificity
HOXC8 - homeo box C8
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00003224-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC8 Antibody (5G1)

  • homeo box C8
  • homeobox C8
  • Homeobox protein Hox-3A
  • homeobox protein Hox-C8
  • HOX3
  • Hox-3.1, mouse, homolog of
  • HOX3Ahomeo box 3A

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23804
Species: Hu, Mu, Rt, Bv, Ca, Pm, Sh
Applications: PEP-ELISA
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
H00003204-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-46001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91973
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, KO
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-83058
Species: Hu
Applications: WB
NBP2-42520
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-85076
Species: Hu
Applications: WB
NBP2-14098
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-87596
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003222-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
H00003231-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for HOXC8 Antibody (H00003224-M01)(1)

Reviews for HOXC8 Antibody (H00003224-M01) (0)

There are no reviews for HOXC8 Antibody (H00003224-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC8 Antibody (H00003224-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOXC8 Products

Bioinformatics Tool for HOXC8 Antibody (H00003224-M01)

Discover related pathways, diseases and genes to HOXC8 Antibody (H00003224-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC8 Antibody (H00003224-M01)

Discover more about diseases related to HOXC8 Antibody (H00003224-M01).
 

Pathways for HOXC8 Antibody (H00003224-M01)

View related products by pathway.

PTMs for HOXC8 Antibody (H00003224-M01)

Learn more about PTMs related to HOXC8 Antibody (H00003224-M01).

Blogs on HOXC8

There are no specific blogs for HOXC8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC8 Antibody (5G1) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC8
Entrez
OMIM
Uniprot