HOXC6 Antibody (2A4)

Western Blot: HOXC6 Antibody (2A4) [H00003223-M04] - Analysis of HOXC6 expression in Hela S3 NE.

ELISA: HOXC6 Antibody (2A4) [H00003223-M04] - Detection limit for recombinant GST tagged HOXC6 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2A4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

HOXC6 Antibody (2A4) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HOXC6 (NP_004494.1, 53 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRR
• Specificity: HOXC6 - homeobox C6 (2A4)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HOXC6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC6 Antibody (2A4)

• CP25
• HHO.C8
• homeo box 3C
• homeo box C6
• homeo box C8 protein
• homeobox C6
• Homeobox protein CP25
• Homeobox protein HHO.C8
• Homeobox protein Hox-3C
• homeobox protein Hox-C6
• HOX3CHOX3

Background

This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXC6 Antibody (H00003223-M04)(1)

Publication using H00003223-M04

• Moon SM, Kim SA, Yoon JH, Ahn SG. HOXC6 is deregulated in human head and neck squamous cell carcinoma and modulates Bcl-2 expression J Biol Chem 2012-08-15 [PMID: 22896703] (WB, Human)

Bioinformatics

• Gene Symbol: HOXC6
• Entrez:
  • 3223(Human)
• Uniprot:
  • NP_004494(Human)