HOXC6 Antibody (2A4)

Images

 
Western Blot: HOXC6 Antibody (2A4) [H00003223-M04] - Analysis of HOXC6 expression in Hela S3 NE.
Sandwich ELISA: HOXC6 Antibody (2A4) [H00003223-M04] - Detection limit for recombinant GST tagged HOXC6 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXC6 Antibody (2A4) Summary

Immunogen
HOXC6 (NP_004494.1, 53 a.a. - 142 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRR
Specificity
HOXC6 - homeobox C6 (2A4)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using
H00003223-M04 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC6 Antibody (2A4)

  • CP25
  • HHO.C8
  • homeo box 3C
  • homeo box C6
  • homeo box C8 protein
  • homeobox C6
  • Homeobox protein CP25
  • Homeobox protein HHO.C8
  • Homeobox protein Hox-3C
  • homeobox protein Hox-C6
  • HOX3CHOX3

Background

This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBL1-11664
Species: Hu
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003223-M04
Species: Hu
Applications: WB, ELISA

Publications for HOXC6 Antibody (H00003223-M04)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HOXC6 Antibody (H00003223-M04) (0)

There are no reviews for HOXC6 Antibody (H00003223-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC6 Antibody (H00003223-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC6 Products

Bioinformatics Tool for HOXC6 Antibody (H00003223-M04)

Discover related pathways, diseases and genes to HOXC6 Antibody (H00003223-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC6 Antibody (H00003223-M04)

Discover more about diseases related to HOXC6 Antibody (H00003223-M04).
 

Pathways for HOXC6 Antibody (H00003223-M04)

View related products by pathway.

PTMs for HOXC6 Antibody (H00003223-M04)

Learn more about PTMs related to HOXC6 Antibody (H00003223-M04).

Blogs on HOXC6

There are no specific blogs for HOXC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC6 Antibody (2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC6
Entrez
Uniprot