HOXD12 Antibody

Images

 
Western Blot: HOXD12 Antibody [NBP2-85074] - WB Suggested Anti-HOXD12 Antibody Titration: 5.0ug/ml. Positive Control: Human Muscle
Immunohistochemistry: HOXD12 Antibody [NBP2-85074] - Human Smooth Muscle

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXD12 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human HOXD12. Peptide sequence: MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HOXD12
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for HOXD12 Antibody

  • homeobox D12
  • Homeobox protein Hox-4H
  • mouse, homolog of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52149
Species: Hu
Applications: ICC/IF, IHC, IHC-P, MiAr, PEP-ELISA
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
1845-SH/CF
Species: Hu
Applications: BA
NBP3-17383
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-85076
Species: Hu
Applications: WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-80228
Species: Hu, Mu
Applications: IHC, IHC-P, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
7460-F4/CF
Species: Hu
Applications: BA
423-F8
Species: Hu, Mu
Applications: BA
345-FG/CF
Species: Hu
Applications: BA
NBP1-06067
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-86103
Species: Hu
Applications: IHC, IHC-P
AF7388
Species: Hu
Applications: IHC
H00003222-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB

Publications for HOXD12 Antibody (NBP2-85074) (0)

There are no publications for HOXD12 Antibody (NBP2-85074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD12 Antibody (NBP2-85074) (0)

There are no reviews for HOXD12 Antibody (NBP2-85074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXD12 Antibody (NBP2-85074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXD12 Products

Bioinformatics Tool for HOXD12 Antibody (NBP2-85074)

Discover related pathways, diseases and genes to HOXD12 Antibody (NBP2-85074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD12 Antibody (NBP2-85074)

Discover more about diseases related to HOXD12 Antibody (NBP2-85074).
 

Pathways for HOXD12 Antibody (NBP2-85074)

View related products by pathway.

PTMs for HOXD12 Antibody (NBP2-85074)

Learn more about PTMs related to HOXD12 Antibody (NBP2-85074).

Blogs on HOXD12

There are no specific blogs for HOXD12, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD12