HOXD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOXD4 Antibody [NBP2-49631] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXD4 Antibody [NBP2-49631] - Staining of human epididymis shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXD4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
Specificity
Specificity of human HOXD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXD4 Recombinant Protein Antigen (NBP2-49631PEP)
Publications
Read Publication using
NBP2-49631 in the following applications:

Reactivity Notes

Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXD4 Antibody

  • HHO.C13
  • homeo box D4
  • homeobox D4
  • Homeobox protein HHO.C13
  • Homeobox protein Hox-4B
  • Homeobox protein Hox-5.1
  • homeobox protein Hox-D4
  • HOX4
  • Hox-4.2
  • Hox-4.2, mouse, homolog of homeo box X
  • HOX4BHOX-5.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-85076
Species: Hu
Applications: WB
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
NBP2-23804
Species: Hu, Mu, Rt, Bv, Ca, Pm, Sh
Applications: PEP-ELISA
H00003224-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, S-ELISA
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003221-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
H00003222-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-87596
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
H00003231-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42520
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HOXD4 Antibody (NBP2-49631)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HOXD4 Antibody (NBP2-49631) (0)

There are no reviews for HOXD4 Antibody (NBP2-49631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXD4 Antibody (NBP2-49631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOXD4 Products

Bioinformatics Tool for HOXD4 Antibody (NBP2-49631)

Discover related pathways, diseases and genes to HOXD4 Antibody (NBP2-49631). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD4 Antibody (NBP2-49631)

Discover more about diseases related to HOXD4 Antibody (NBP2-49631).
 

Pathways for HOXD4 Antibody (NBP2-49631)

View related products by pathway.

PTMs for HOXD4 Antibody (NBP2-49631)

Learn more about PTMs related to HOXD4 Antibody (NBP2-49631).

Blogs on HOXD4

There are no specific blogs for HOXD4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD4