HOXD4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HOXD4 Antibody [NBP2-49631] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HOXD4 Antibody [NBP2-49631] - Staining of human epididymis shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOXD4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HOXD4 Antibody - BSA Free (NBP2-49631) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-HOXD4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HOXD4 Recombinant Protein Antigen (NBP2-49631PEP)

Reactivity Notes

Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HOXD4 Antibody - BSA Free

• HHO.C13
• homeo box D4
• homeobox D4
• Homeobox protein HHO.C13
• Homeobox protein Hox-4B
• Homeobox protein Hox-5.1
• homeobox protein Hox-D4
• HOX4
• Hox-4.2
• Hox-4.2, mouse, homolog of homeo box X
• HOX4BHOX-5.1

Background

HOXD4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXD4 Antibody (NBP2-49631)(1)

Publication using NBP2-49631

• Arnold A, Imada EL, Zhang ML et al. Differential gene methylation and expression of HOX transcription factor family in orbitofacial neurofibroma Acta Neuropathol Commun 2020-05-04 [PMID: 32366326] (IF/IHC, IHC-P, Human)

Bioinformatics

• Gene Symbol: HOXD4