HOXC13 Antibody (10D4)

Images

 
Western Blot: HOXC13 Antibody (10D4) [H00003229-M01] - HOXC13 monoclonal antibody (M01), clone 10D4 Analysis of HOXC13 expression in A-549.
Sandwich ELISA: HOXC13 Antibody (10D4) [H00003229-M01] - Detection limit for recombinant GST tagged HOXC13 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
10D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXC13 Antibody (10D4) Summary

Immunogen
HOXC13 (NP_059106, 132 a.a. - 231 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSK
Specificity
HOXC13 - homeo box C13
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00003229-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC13 Antibody (10D4)

  • homeo box 3G
  • homeo box C13
  • homeobox C13
  • Homeobox protein Hox-3G
  • homeobox protein Hox-C13
  • HOX3
  • HOX3GNUP98/HOXC13

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the development of hair, nail, and filiform papilla.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23665
Species: Mu
Applications: WB
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-46000
Species: Hu
Applications: WB, IHC
NB100-93325
Species: Hu
Applications: WB, IP
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003886-D01P
Species: Hu
Applications: WB

Publications for HOXC13 Antibody (H00003229-M01)(2)

Reviews for HOXC13 Antibody (H00003229-M01) (0)

There are no reviews for HOXC13 Antibody (H00003229-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC13 Antibody (H00003229-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC13 Products

Bioinformatics Tool for HOXC13 Antibody (H00003229-M01)

Discover related pathways, diseases and genes to HOXC13 Antibody (H00003229-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC13 Antibody (H00003229-M01)

Discover more about diseases related to HOXC13 Antibody (H00003229-M01).
 

Pathways for HOXC13 Antibody (H00003229-M01)

View related products by pathway.

PTMs for HOXC13 Antibody (H00003229-M01)

Learn more about PTMs related to HOXC13 Antibody (H00003229-M01).

Blogs on HOXC13

There are no specific blogs for HOXC13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC13 Antibody (10D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC13
Entrez
OMIM
Uniprot