HOXB7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOXB7 Antibody [NBP2-14098] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human urinary bladder shows strong cytoplasmic, membranous and nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXB7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXB7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
HOXB7 Protein (NBP2-14098PEP)
Publications
Read Publication using NBP2-14098.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24859338)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXB7 Antibody

  • HHO.C1
  • homeo box 2C
  • homeo box B7
  • homeo box c1 protein
  • homeobox B7
  • Homeobox protein HHO.C1
  • Homeobox protein Hox-2C
  • homeobox protein Hox-B7
  • HOX2
  • Hox-2.3
  • HOX2C
  • HOX2CHox-2.3
  • HOXB7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003216-M01-100ug
Species: Hu
Applications: WB, ELISA
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-56537
Species: Hu
Applications: ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00003219-D03P
Species: Hu, Mu
Applications: WB
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
AF482
Species: Mu
Applications: WB, IHC
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB

Publications for HOXB7 Antibody (NBP2-14098)(1)


Reviews for HOXB7 Antibody (NBP2-14098) (0)

There are no reviews for HOXB7 Antibody (NBP2-14098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXB7 Antibody (NBP2-14098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB7 Products

Bioinformatics Tool for HOXB7 Antibody (NBP2-14098)

Discover related pathways, diseases and genes to HOXB7 Antibody (NBP2-14098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB7 Antibody (NBP2-14098)

Discover more about diseases related to HOXB7 Antibody (NBP2-14098).
 

Pathways for HOXB7 Antibody (NBP2-14098)

View related products by pathway.

PTMs for HOXB7 Antibody (NBP2-14098)

Learn more about PTMs related to HOXB7 Antibody (NBP2-14098).

Blogs on HOXB7

There are no specific blogs for HOXB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB7
Entrez