HOXB7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HOXB7 Antibody [NBP2-14098] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli and cytoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOXB7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXB7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  HOXB7 Protein (NBP2-14098PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 30348677)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HOXB7 Antibody - BSA Free

• HHO.C1
• homeo box 2C
• homeo box B7
• homeo box c1 protein
• homeobox B7
• Homeobox protein HHO.C1
• Homeobox protein Hox-2C
• homeobox protein Hox-B7
• HOX2
• Hox-2.3
• HOX2C
• HOX2CHox-2.3
• HOXB7

Background

HOXB7 is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXB7 Antibody (NBP2-14098)(5)

Publications using NBP2-14098

• Chen J, Luo J, He J et al. Cell Cycle-Related Gene SPC24: A Novel Potential Diagnostic and Prognostic Biomarker for Laryngeal Squamous Cell Cancer BioMed Research International 2023-01-21 [PMID: 36718148]
• Komatsuda H, Wakisaka R, Kono M et al. Mitogen-activated protein kinase inhibition augments the T cell response against HOXB7-expressing tumor through human leukocyte antigen upregulation Cancer Science 2023-02-01 [PMID: 36285482]
• Mo J, Anastasaki C, Chen Z et al. Humanized neurofibroma model from induced pluripotent stem cells delineates tumor pathogenesis and developmental origins J Clin Invest 2020-10-27 [PMID: 33108355]
• Chen Z, Mo J, Brosseau JP et al. Spatiotemporal loss of NF1 in Schwann cell lineage leads to different types of cutaneous neurofibroma susceptible to modification by the Hippo pathway. Cancer Discov. 2018-10-22 [PMID: 30348677] (IHC-P, Mouse)
• Wang X, Bledsoe KL, Graham RP et al. Recurrent PAX3-MAML3 fusion in biphenotypic sinonasal sarcoma. Nat Genet 2014-07-01 [PMID: 24859338]

Bioinformatics

• Gene Symbol: HOXB7