HOXB7 Antibody


Immunocytochemistry/ Immunofluorescence: HOXB7 Antibody [NBP2-14098] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

HOXB7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI
Specificity of human HOXB7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
HOXB7 Protein (NBP2-14098PEP)
Read Publications using
NBP2-14098 in the following applications:

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 30348677)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HOXB7 Antibody

  • HHO.C1
  • homeo box 2C
  • homeo box B7
  • homeo box c1 protein
  • homeobox B7
  • Homeobox protein HHO.C1
  • Homeobox protein Hox-2C
  • homeobox protein Hox-B7
  • HOX2
  • Hox-2.3
  • HOX2C
  • HOX2CHox-2.3
  • HOXB7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu
Applications: WB
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu
Applications: WB, ChIP, ELISA, IP, S-ELISA
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv, Ca, Pm, Sh
Applications: PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Pm
Applications: WB

Publications for HOXB7 Antibody (NBP2-14098)(3)

Reviews for HOXB7 Antibody (NBP2-14098) (0)

There are no reviews for HOXB7 Antibody (NBP2-14098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXB7 Antibody (NBP2-14098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional HOXB7 Products

Bioinformatics Tool for HOXB7 Antibody (NBP2-14098)

Discover related pathways, diseases and genes to HOXB7 Antibody (NBP2-14098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB7 Antibody (NBP2-14098)

Discover more about diseases related to HOXB7 Antibody (NBP2-14098).

Pathways for HOXB7 Antibody (NBP2-14098)

View related products by pathway.

PTMs for HOXB7 Antibody (NBP2-14098)

Learn more about PTMs related to HOXB7 Antibody (NBP2-14098).

Blogs on HOXB7

There are no specific blogs for HOXB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXB7 Antibody and receive a gift card or discount.


Gene Symbol HOXB7