HOXB4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HOXB4 Antibody - BSA Free (NBP2-33833) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY |
| Predicted Species |
Mouse (97%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HOXB4 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for HOXB4 Antibody - BSA Free
Background
Homebox transcription factors (Hox) are encoded by highly conserved developmental genes that are involved embryonic and early hematopoietic development. Specifically, Homeobox B4 (HoxB4) is a transcription factor encoded by HOXB4 gene and it is involved in the developmental regulation of specific positional identities on the anterior-posterior axis of cells. Like all members of HOX family, HoXB4 is abundantly expressed in primitive hematopoietic stem cell (HSC), but then decline with lineage-specific terminal differentiation (1). In HSC, stem cell self-renewal activity is regulated by USF1/2 binding to HoxB4, where binding possibly favors stem cell self-renewal instead of cell differentiation. Jun-B and Fra-1 has been linked as key mediators during cell proliferation and differentiation induced by HoxB4, which leads to increase expression of Cyclin D1 and G1 shortening (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for HOXB4 Antibody (NBP2-33833) (0)
There are no publications for HOXB4 Antibody (NBP2-33833).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOXB4 Antibody (NBP2-33833) (0)
There are no reviews for HOXB4 Antibody (NBP2-33833).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HOXB4 Antibody (NBP2-33833) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOXB4 Products
Blogs on HOXB4