HOXB13 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXB13. Source: E. coli
Amino Acid Sequence: YATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HOXB13 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49375. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HOXB13 Recombinant Protein Antigen
Background
HOXB13 is a novel member of the AbdB subfamily of vertebrate HOX genes which are clustered in 4 unlinked complexes in the genome (HOXA, HOXB, HOXC, and HOXD clusters) which each span about 200 kb and contains 9 to 11 genes, transcribed from the same strand of DNA. The order of the HOX genes along the chromosome correlates with their expression along the anterior/posterior axis of the embryo and suggests that their organization is integral to their proper regulation. Members of the Abdominal B (AbdB) subfamily of homeobox genes exhibit posterior domains of expression, including the developing urogenital system, in vertebrates. Several HOXB genes have been described in humans and other mammals though it was thought that HOXB genes 10 through 13 had been lost in evolution until HOXB13 was discovered. HOXB13 gene contains 2 exons and encodes a 284-amino acid protein, 2 residues shorter than the mouse protein. It is separated from HOXB9 by 70 kb but is transcribed in the same orientation as the other HOXB genes. The 60-amino acid homeodomain, located near the C terminus of the protein, demonstrated 78 to 83% identity with HOX proteins in paralog group 13 of the AbdB subfamily; 6 of the amino acid differences from other member of this group represented conservative changes. HOXB13 had less than 60% identity to other AbdB-related genes. Mouse Hoxb13 is expressed first in the tailbud of embryonic mice and subsequently in the hindgut, urogenital tract, and the posterior extent of the spinal cord. It is not expressed in the secondary axes. During the first 2 trimesters of development, wound healing occurs without scars. Two homeobox genes, PRX2 and HOXB13, are differentially expressed during fetal versus adult wound healing. Both genes are expressed in proliferating fibroblasts and fetal dermis, but not in adult dermis. The HOXB13 gene has been mapped to human chromosome 17q21.2, where other HOXB genes are clustered, whilst the mouse Hoxb13 gene mapped to chromosome 11.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC-P
Species: Hu
Applications: ICC
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Publications for HOXB13 Recombinant Protein Antigen (NBP2-49375PEP) (0)
There are no publications for HOXB13 Recombinant Protein Antigen (NBP2-49375PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOXB13 Recombinant Protein Antigen (NBP2-49375PEP) (0)
There are no reviews for HOXB13 Recombinant Protein Antigen (NBP2-49375PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HOXB13 Recombinant Protein Antigen (NBP2-49375PEP) (0)
Additional HOXB13 Products
Research Areas for HOXB13 Recombinant Protein Antigen (NBP2-49375PEP)
Find related products by research area.
|
Blogs on HOXB13