HOXA10 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HOXA10 Antibody - BSA Free (NBP3-04877) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 236-336 of human HOXA10 (NP_061824.3). LGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HOXA10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HOXA10 Antibody - BSA Free
Background
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters namedA, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated duringembryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcriptionfactor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function infertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcriptvariants encoding different isoforms have been described. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Publications for HOXA10 Antibody (NBP3-04877) (0)
There are no publications for HOXA10 Antibody (NBP3-04877).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOXA10 Antibody (NBP3-04877) (0)
There are no reviews for HOXA10 Antibody (NBP3-04877).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HOXA10 Antibody (NBP3-04877) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOXA10 Products
Blogs on HOXA10