HOOK1 Antibody (1D11)

Images

 
Western Blot: HOOK1 Antibody (1D11) [H00051361-M02] - OK1 monoclonal antibody (M02), clone 1D11. Western Blot analysis of HOOK1 expression in MCF-7 ( Cat # L046V1 ).
Immunohistochemistry-Paraffin: HOOK1 Antibody (1D11) [H00051361-M02] - Analysis of monoclonal antibody to HOOK1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: HOOK1 Antibody (1D11) [H00051361-M02] - Detection limit for recombinant GST tagged HOOK1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOOK1 Antibody (1D11) Summary

Immunogen
HOOK1 (NP_056972, 632 a.a. ~ 728 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTPARSFLAQQRHITNTRRNLSVKVPATTSD
Specificity
HOOK1 - hook homolog 1 (Drosophila) (1D11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOOK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOOK1 Antibody (1D11)

  • hHK1
  • HK1h-hook1
  • hook homolog 1 (Drosophila)
  • MGC10642
  • protein Hook homolog 1

Background

This gene encodes a member of the hook family of coiled-coil proteins, which bind to microtubules and organelles through their N- and C-terminal domains, respectively. The encoded protein localizes to discrete punctuate subcellular structures, and interacts with several members of the Rab GTPase family involved in endocytosis. It is thought to link endocytic membrane trafficking to the microtubule cytoskeleton. Several alternatively spliced transcript variants have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16814
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP2-14986
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4104
Species: Hu
Applications: WB, IP, Neut
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP, KO
NBP2-76939
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-81990
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut

Publications for HOOK1 Antibody (H00051361-M02) (0)

There are no publications for HOOK1 Antibody (H00051361-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOOK1 Antibody (H00051361-M02) (0)

There are no reviews for HOOK1 Antibody (H00051361-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOOK1 Antibody (H00051361-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOOK1 Products

Bioinformatics Tool for HOOK1 Antibody (H00051361-M02)

Discover related pathways, diseases and genes to HOOK1 Antibody (H00051361-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOOK1 Antibody (H00051361-M02)

Discover more about diseases related to HOOK1 Antibody (H00051361-M02).
 

Pathways for HOOK1 Antibody (H00051361-M02)

View related products by pathway.

Blogs on HOOK1

There are no specific blogs for HOOK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOOK1 Antibody (1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOOK1
Entrez
Uniprot