HOGA1 Antibody

Images

 
Immunohistochemistry: HOGA1 Antibody [NBP2-14097] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOGA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQ VGADAAMVVTPCYYRGRMSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOGA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HOGA1 Protein (NBP2-14097PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOGA1 Antibody

  • 4-hydroxy-2-oxoglutarate aldolase 1
  • C10orf65
  • chromosome 10 open reading frame 65
  • DHDPS2
  • DHDPSLHP3
  • DHDPS-like protein
  • Dihydrodipicolinate synthase-like
  • dihydrodipicolinate synthase-like, mitochondrial
  • dihydrodipicolinate synthetase homolog 2
  • EC 4.1.3.16
  • FLJ37472
  • FLJ56960
  • N-acetylneuraminate pyruvate lyase 2 (putative)
  • NPL2
  • Probable 2-keto-4-hydroxyglutarate aldolase
  • probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial
  • Probable KHG-aldolase
  • Protein 569272

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-31848
Species: Hu
Applications: IHC, IHC-P
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
7707-NP
Species: Hu
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready

Publications for HOGA1 Antibody (NBP2-14097) (0)

There are no publications for HOGA1 Antibody (NBP2-14097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOGA1 Antibody (NBP2-14097) (0)

There are no reviews for HOGA1 Antibody (NBP2-14097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HOGA1 Antibody (NBP2-14097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOGA1 Products

Bioinformatics Tool for HOGA1 Antibody (NBP2-14097)

Discover related pathways, diseases and genes to HOGA1 Antibody (NBP2-14097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOGA1 Antibody (NBP2-14097)

Discover more about diseases related to HOGA1 Antibody (NBP2-14097).
 

Pathways for HOGA1 Antibody (NBP2-14097)

View related products by pathway.

Blogs on HOGA1

There are no specific blogs for HOGA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOGA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOGA1