hnRNP U Recombinant Protein Antigen

Images

 
There are currently no images for hnRNP U Recombinant Protein Antigen (NBP2-48729PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

hnRNP U Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human hnRNP U.

Source: E. coli

Amino Acid Sequence: TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNRNPU
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48729.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for hnRNP U Recombinant Protein Antigen

  • heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
  • heterogeneous nuclear ribonucleoprotein U
  • hnRNP U
  • HNRPU
  • p120 nuclear protein
  • p120
  • pp120
  • SAFA
  • SAF-AhnRNPU
  • Scaffold attachment factor A
  • U21.1

Background

hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
1544-IR
Species: Hu
Applications: Bind
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-76855
Species: Hu
Applications: ELISA, ICC/IF, WB
MPTX20
Species: Mu
Applications: ELISA
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IM, KD, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA

Publications for hnRNP U Recombinant Protein Antigen (NBP2-48729PEP) (0)

There are no publications for hnRNP U Recombinant Protein Antigen (NBP2-48729PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP U Recombinant Protein Antigen (NBP2-48729PEP) (0)

There are no reviews for hnRNP U Recombinant Protein Antigen (NBP2-48729PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for hnRNP U Recombinant Protein Antigen (NBP2-48729PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hnRNP U Products

Research Areas for hnRNP U Recombinant Protein Antigen (NBP2-48729PEP)

Find related products by research area.

Blogs on hnRNP U

There are no specific blogs for hnRNP U, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our hnRNP U Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPU