hnRNP-Q Antibody

Western Blot: hnRNP-Q Antibody [NBP1-57197] - HepG2 cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 1 mg/ml

hnRNP-Q Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SYNCRIP(synaptotagmin binding, cytoplasmic RNA interacting protein) The peptide sequence was selected from the middle region of SYNCRIP. Peptide sequence IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYNCRIP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31484926).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for hnRNP-Q Antibody

• dJ3J17.2
• Glycine- and tyrosine-rich RNA-binding protein
• GRYRBP
• GRY-RBPNS1-associated protein 1
• heterogeneous nuclear ribonucleoprotein Q
• hnRNP Q
• hnRNP-Q
• HNRPQ
• HNRPQ1
• NSAP1FLJ31626
• PP68
• synaptotagmin binding, cytoplasmic RNA interacting protein
• Synaptotagmin-binding, cytoplasmic RNA-interacting protein

Background

Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for hnRNP-Q Antibody (NBP1-57197)(1)

Publication using NBP1-57197

• Oliveira-Mateos C, Sanchez-Castillo A, Soler M et al. The transcribed pseudogene RPSAP52 enhances the oncofetal HMGA2-IGF2BP2-RAS axis through LIN28B-dependent and independent let-7 inhibition Nat Commun 2019-09-04 [PMID: 31484926] (WB, Mouse)

Bioinformatics

• Gene Symbol: SYNCRIP
• Uniprot:
  • O60506(Human)