hnRNP M1-M4 Antibody

Images

 
Western Blot: hnRNP M1-M4 Antibody [NBP1-84555] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: hnRNP M1-M4 Antibody [NBP1-84555] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: hnRNP M1-M4 Antibody [NBP1-84555] - Staining of human pancreas shows strong nuclear positivity.
Western Blot: hnRNP M1-M4 Antibody [NBP1-84555] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP M1-M4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NKMGGMEGPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
hnRNP M1-M4 Protein (NBP1-84555PEP)
Publications
Read Publication using NBP1-84555.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23864636)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hnRNP M1-M4 Antibody

  • DKFZp547H118
  • heterogeneous nuclear ribonucleoprotein M
  • hnRNP M
  • HNRNPM4
  • HNRPM4heterogenous nuclear ribonucleoprotein M
  • HNRPMheterogenous nuclear ribonucleoprotein M4
  • HTGR1
  • M4 protein
  • N-acetylglucosamine receptor 1
  • NAGR1hnRNA-binding protein M4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46231
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005670-T01
Species: Hu
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3446
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84555
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for hnRNP M1-M4 Antibody (NBP1-84555)(1)

Reviews for hnRNP M1-M4 Antibody (NBP1-84555) (0)

There are no reviews for hnRNP M1-M4 Antibody (NBP1-84555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hnRNP M1-M4 Antibody (NBP1-84555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP M1-M4 Products

Bioinformatics Tool for hnRNP M1-M4 Antibody (NBP1-84555)

Discover related pathways, diseases and genes to hnRNP M1-M4 Antibody (NBP1-84555). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP M1-M4 Antibody (NBP1-84555)

Discover more about diseases related to hnRNP M1-M4 Antibody (NBP1-84555).
 

Pathways for hnRNP M1-M4 Antibody (NBP1-84555)

View related products by pathway.

PTMs for hnRNP M1-M4 Antibody (NBP1-84555)

Learn more about PTMs related to hnRNP M1-M4 Antibody (NBP1-84555).
 

Research Areas for hnRNP M1-M4 Antibody (NBP1-84555)

Find related products by research area.

Blogs on hnRNP M1-M4

There are no specific blogs for hnRNP M1-M4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP M1-M4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPM