hnRNP K Antibody

Images

 
Immunohistochemistry-Paraffin: hnRNP K Antibody [NBP1-84374] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP K Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
hnRNP K Protein (NBP1-84374PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hnRNP K Antibody

  • dC-stretch binding protein
  • FLJ41122
  • heterogeneous nuclear ribonucleoprotein K
  • hnRNP K
  • transformation upregulated nuclear protein
  • Transformation up-regulated nuclear protein
  • TUNPHNRPKCSBP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-2776
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56446
Species: Hu, Mu, Rt
Applications: WB
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84374
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for hnRNP K Antibody (NBP1-84374) (0)

There are no publications for hnRNP K Antibody (NBP1-84374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP K Antibody (NBP1-84374) (0)

There are no reviews for hnRNP K Antibody (NBP1-84374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for hnRNP K Antibody (NBP1-84374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP K Products

Bioinformatics Tool for hnRNP K Antibody (NBP1-84374)

Discover related pathways, diseases and genes to hnRNP K Antibody (NBP1-84374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP K Antibody (NBP1-84374)

Discover more about diseases related to hnRNP K Antibody (NBP1-84374).
 

Pathways for hnRNP K Antibody (NBP1-84374)

View related products by pathway.

PTMs for hnRNP K Antibody (NBP1-84374)

Learn more about PTMs related to hnRNP K Antibody (NBP1-84374).
 

Research Areas for hnRNP K Antibody (NBP1-84374)

Find related products by research area.

Blogs on hnRNP K

There are no specific blogs for hnRNP K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPK