hnRNP K Antibody


Immunohistochemistry-Paraffin: hnRNP K Antibody [NBP1-84374] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

hnRNP K Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVS
Specificity of human hnRNP K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
hnRNP K Protein (NBP1-84374PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for hnRNP K Antibody

  • dC-stretch binding protein
  • FLJ41122
  • heterogeneous nuclear ribonucleoprotein K
  • hnRNP K
  • transformation upregulated nuclear protein
  • Transformation up-regulated nuclear protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Ma
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for hnRNP K Antibody (NBP1-84374) (0)

There are no publications for hnRNP K Antibody (NBP1-84374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP K Antibody (NBP1-84374) (0)

There are no reviews for hnRNP K Antibody (NBP1-84374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for hnRNP K Antibody (NBP1-84374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional hnRNP K Products

Bioinformatics Tool for hnRNP K Antibody (NBP1-84374)

Discover related pathways, diseases and genes to hnRNP K Antibody (NBP1-84374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP K Antibody (NBP1-84374)

Discover more about diseases related to hnRNP K Antibody (NBP1-84374).

Pathways for hnRNP K Antibody (NBP1-84374)

View related products by pathway.

PTMs for hnRNP K Antibody (NBP1-84374)

Learn more about PTMs related to hnRNP K Antibody (NBP1-84374).

Research Areas for hnRNP K Antibody (NBP1-84374)

Find related products by research area.

Blogs on hnRNP K

There are no specific blogs for hnRNP K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our hnRNP K Antibody and receive a gift card or discount.


Gene Symbol HNRNPK