hnRNP AB Antibody

Images

 
Western Blot: hnRNP AB Antibody [NBP1-57172] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP AB Antibody Summary

Immunogen
Synthetic peptides corresponding to HNRPAB The peptide sequence was selected from the N terminal of HNRPAB. Peptide sequence GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPAB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HNRPAB and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for hnRNP AB Antibody

  • catalytic polypeptide 1-binding protein 1
  • heterogeneous nuclear ribonucleoprotein A/B
  • hnRNP A/B
  • hnRNP type A/B protein

Background

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pr

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19533
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80486
Species: Hu
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP

Publications for hnRNP AB Antibody (NBP1-57172) (0)

There are no publications for hnRNP AB Antibody (NBP1-57172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP AB Antibody (NBP1-57172) (0)

There are no reviews for hnRNP AB Antibody (NBP1-57172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hnRNP AB Antibody (NBP1-57172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP AB Products

Bioinformatics Tool for hnRNP AB Antibody (NBP1-57172)

Discover related pathways, diseases and genes to hnRNP AB Antibody (NBP1-57172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP AB Antibody (NBP1-57172)

Discover more about diseases related to hnRNP AB Antibody (NBP1-57172).
 

Pathways for hnRNP AB Antibody (NBP1-57172)

View related products by pathway.

PTMs for hnRNP AB Antibody (NBP1-57172)

Learn more about PTMs related to hnRNP AB Antibody (NBP1-57172).
 

Research Areas for hnRNP AB Antibody (NBP1-57172)

Find related products by research area.

Blogs on hnRNP AB

There are no specific blogs for hnRNP AB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP AB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPAB
Uniprot