hnRNP AB Antibody


Western Blot: hnRNP AB Antibody [NBP1-57172] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

hnRNP AB Antibody Summary

Synthetic peptides corresponding to HNRPAB The peptide sequence was selected from the N terminal of HNRPAB. Peptide sequence GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HNRPAB and was validated on Western blot.
Positive Control
hnRNP AB Lysate (NBP2-65779)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for hnRNP AB Antibody

  • catalytic polypeptide 1-binding protein 1
  • heterogeneous nuclear ribonucleoprotein A/B
  • hnRNP A/B
  • hnRNP type A/B protein


This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pr


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, ChIP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP

Publications for hnRNP AB Antibody (NBP1-57172) (0)

There are no publications for hnRNP AB Antibody (NBP1-57172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP AB Antibody (NBP1-57172) (0)

There are no reviews for hnRNP AB Antibody (NBP1-57172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hnRNP AB Antibody (NBP1-57172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional hnRNP AB Products

Bioinformatics Tool for hnRNP AB Antibody (NBP1-57172)

Discover related pathways, diseases and genes to hnRNP AB Antibody (NBP1-57172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP AB Antibody (NBP1-57172)

Discover more about diseases related to hnRNP AB Antibody (NBP1-57172).

Pathways for hnRNP AB Antibody (NBP1-57172)

View related products by pathway.

PTMs for hnRNP AB Antibody (NBP1-57172)

Learn more about PTMs related to hnRNP AB Antibody (NBP1-57172).

Research Areas for hnRNP AB Antibody (NBP1-57172)

Find related products by research area.

Blogs on hnRNP AB

There are no specific blogs for hnRNP AB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our hnRNP AB Antibody and receive a gift card or discount.


Gene Symbol HNRNPAB