HNF-4 gamma/NR2A2 Antibody - BSA Free

Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52810] - Human Adult Placenta Antibody Dilution: 1.0 ug/ml.

Western Blot: HNF-4 gamma/NR2A2 Antibody [NBP1-52810] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HNF-4 gamma/NR2A2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HNF4G(hepatocyte nuclear factor 4, gamma) The peptide sequence was selected from the C terminal of HNF4G (NP_004124). Peptide sequence QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNF4G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HNF-4 gamma/NR2A2 Antibody - BSA Free

• hepatocyte nuclear factor 4, gamma
• hepatocyte nuclear factor 4-gamma
• HNF4 gamma
• HNF-4 gamma
• HNF4G
• HNF-4-gamma
• NR2A2
• NR2A2Nuclear receptor subfamily 2 group A member 2
• NR2A3

Background

HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNF4G
• Entrez:
  • 3174(Human)
• Uniprot:
  • Q14541(Human)