HNF-3 beta/FoxA2 Antibody (7E6) - Azide and BSA Free

Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody (M01), clone 7E6.Lane 1: FOXA2 transfected lysate(48.3 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of monoclonal antibody to FOXA2 on HepG2 cell. Antibody concentration 10 ug/ml.

Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi ( Cat # H00003170-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA2 monoclonal antibody (M01), clone 7E6 (Cat # H00003170-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - FOXA2 monoclonal antibody (M01), clone 7E6 Analysis of FOXA2 expression in HepG2.

Immunoprecipitation: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 transfected lysate using anti-FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 MaxPab rabbit polyclonal antibody.

ELISA: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Detection limit for recombinant GST tagged FOXA2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IP, KD
• Clone: 7E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HNF-3 beta/FoxA2 Antibody (7E6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
• Specificity: FOXA2 - forkhead box A2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FOXA2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HNF-3 beta/FoxA2 Antibody (7E6) - Azide and BSA Free

• forkhead box A2
• Forkhead box protein A2
• FoxA2
• hepatic nuclear factor-3-beta
• hepatocyte nuclear factor 3, beta
• hepatocyte nuclear factor 3-beta
• HNF3 beta
• HNF-3 beta
• HNF-3B
• HNF-3-beta
• HNF3BTCF-3B
• MGC19807
• TCF3B
• Transcription factor 3B

Background

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HNF-3 beta/FoxA2 Antibody (H00003170-M01)(5)

Publications using H00003170-M01

• Sanchez J, Rankin S, Paul E et al. Human organoid modeling of congenital malformations caused by RFX6 mutations reveal an essential role for this transcription factor in establishing and maintaining duodenal identity upstream of PDX1 bioRxiv 2023-11-11
• S Mukherjee, DM Luedeke, L McCoy, M Iwafuchi, AM Zorn SOX transcription factors direct TCF-independent WNT/beta-catenin responsive transcription to govern cell fate in human pluripotent stem cells Cell Reports, 2022-08-23;40(8):111247. 2022-08-23 [PMID: 36001974]
• Oz-Levi D, Olender T, Bar-Joseph I et al. Noncoding deletions reveal a gene that is critical for intestinal function Nature 2019-07-01 [PMID: 31217582] (ICC/IF, Human)
• McCracken KW and Wells JM. Generation of human antral and fundic gastric organoids from pluripotent stem cells. Nat Protoc. 2019-01-01 [PMID: 30470820]
• Miyawaki S, Kawamura Y, Oiwa Y et al. Tumour resistance in induced pluripotent stem cells derived from naked mole-rats. Nat Commun 2016-05-10 [PMID: 27161380]

Bioinformatics

• Gene Symbol: FOXA2
• Entrez:
  • 3170(Human)
• OMIM:
  • 600288(Human)
• Uniprot:
  • NP_068556(Human)