Home » HNF-3 beta/FoxA2 » HNF-3 beta/FoxA2 Antibodies » HNF-3 beta/FoxA2 Antibody (7E6)

HNF-3 beta/FoxA2 Antibody (7E6)

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody (M01), clone 7E6.Lane 1: FOXA2 transfected lysate(48.3 KDa).Lane 2: Non-transfected lysate.
Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody (M01), clone 7E6.Lane 1: FOXA2 transfected lysate(48.3 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of monoclonal antibody to FOXA2 on HepG2 cell. Antibody concentration 10 ug/ml.
Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi ( Cat # H00003170-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - FOXA2 monoclonal antibody (M01), clone 7E6 Analysis of FOXA2 expression in HepG2.
Immunoprecipitation: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 transfected lysate using anti-FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 MaxPab rabbit ...read more
ELISA: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Detection limit for recombinant GST tagged FOXA2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, KD
Clone
7E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HNF-3 beta/FoxA2 Antibody (7E6) Summary

Immunogen
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Specificity
FOXA2 - forkhead box A2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.
Publications
Read Publications using
H00003170-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HNF-3 beta/FoxA2 Antibody (7E6)

  • forkhead box A2
  • Forkhead box protein A2
  • FoxA2
  • hepatic nuclear factor-3-beta
  • hepatocyte nuclear factor 3, beta
  • hepatocyte nuclear factor 3-beta
  • HNF3 beta
  • HNF-3 beta
  • HNF-3B
  • HNF-3-beta
  • HNF3BTCF-3B
  • MGC19807
  • TCF3B
  • Transcription factor 3B

Background

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Analysis using the Azide Free version of NBP2-45269. Staining of HepG2 cells (1 x 10^6 cells/ml) with FOXA1 antibody, clone 3B11NB (orange), shown with the negative control (blue).
Flow Cytometry: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Analysis using the Azide Free version of NBP2-45269. Staining of LnCAP cells (1 x 10^6 cells/ml) with FOXA1 antibody, clone 3B11NB (orange), shown with the negative control (blue).
Western Blot: HNF-3 alpha/FoxA1 Antibody (3B11NB) [NBP2-45269] - Analysis of FOXA1 (3B11NB) in partial recombinant FOXA1 protein and PC3 lysate, respectivetly.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FOXA3 Antibody
NBP2-87461
Immunohistochemistry: FOXA3 Antibody [NBP2-87461] - Human Lung
Western Blot: FOXA3 Antibody [NBP2-87461] - WB Suggested Anti-FOXA3 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate
Western Blot: FOXA3 Antibody [NBP2-87461] - Host: Rabbit. Target Name: FOXA3. Sample Tissue: Mouse Skeletal Muscle. Antibody Dilution: 1ug/ml
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
HNF1 Antibody
NBP1-33596
Western Blot: HNF1 Antibody [NBP1-33596] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HNF1 Antibody [NBP1-33596] - Analysis. Mouse tissue extracts (50 Ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:2000.
Western Blot: HNF1 Antibody [NBP1-33596] - Rat tissue extracts (50 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with HNF1 alpha antibody [N1N3] diluted at 1:1000.
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
HNF-6/ONECUT1
Antibody
NBP2-27079
Immunohistochemistry-Paraffin: HNF-6/ONECUT1 Antibody [NBP2-27079] - Analysis of HNF6 in formalin-fixed, paraffin-embedded human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Western Blot: HNF-6/ONECUT1 Antibody [NBP2-27079] - Analysis ofHNF6 inhuman pancreas in the 1) absence and 2) presence of immunizing peptide, and 3) rat pancreasusing this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(56 Publications)
Species: Hu
Applications: BA
FoxM1 Antibody
NBP1-84671
Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 expansion supplement for 24 hours in the presence of drug or 0.1% DMSO. Cells were then harvested for Western blot. Treated cells were harvested and lysed using IP buffer. Protein concentration was determined. Isolated proteins were separated on SDS-PAGE and transferred to PVDF membrane. Immunoblotting was carried out with antibodies specific for FOXM1 and B-actin. This image was submitted via customer review.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunocytochemistry/Immunofluorescence: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human kidney shows moderate to strong nuclear positivity in renal tubules.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western blot shows lysates of beta TC‑6 mouse beta cell insulinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDX‑1/IPF1 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
PDX‑1/IPF1 was detected in immersion fixed BG01V human embryonic stem cells differentiated into pancreatic progenitor cells using Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 493-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL003) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Simple Western lane view shows lysates of beta TC‑6 mouse beta cell insulinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PDX‑1/IPF1 at approximately 48 kDa (as indicated) using 10 µg/mL of Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(36 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining in human duodenum and tonsil tissues using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same tissues.
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - TTF1 staining in thyroid tissue of wild-type C57 mouse (red). Dilution is 1:100. Image from a verified customer review.
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Thyroid stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Lung Carcinoma stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
SOX17 Antibody
[Unconjugated]
AF1924
Endoderm-differentiated D3 mouse embryonic stem cell line was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. SOX17/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human SOX17 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1924) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The p21 promoter was detected by standard PCR.
Simple Western lane view shows lysates of BG01V human embryonic stem cells untreated (-) or endoderm differentiated (+), loaded at 0.2 mg/mL. A specific band was detected for SOX17 at approximately 59 kDa (as indicated) using 10 µg/mL of Goat Anti-Human SOX17 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1924) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
SOX17 was detected in immersion fixed B16 mouse melanoma cell line using 10 µg/mL Goat Anti-Human SOX17 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1924) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(269 Publications)
Species: Hu
Applications: ChIP, ICC, Simple Western, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry: Transthyretin/Prealbumin Antibody (2E10C5) [NBP2-52575] - Analysis of A549 cells using TTR mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: Transthyretin/Prealbumin Antibody (2E10C5) [NBP2-52575] - Analysis of A549 cells using TTR mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Immunocytochemistry/Immunofluorescence: Transthyretin/Prealbumin Antibody (2E10C5) [NBP2-52575] - Analysis of MCF-7 cells using TTR mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MLX Antibody
[Unconjugated]
AF4186
Western blot shows nuclear extracts of PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human MLX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4186) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for MLX at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Publication)
Species: Hu
Applications: ICC, WB
PDHX Antibody
NBP1-84079
Immunohistochemistry-Paraffin: PDHX Antibody [NBP1-84079] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: PDHX Antibody [NBP1-84079] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PDHX Antibody [NBP1-84079] - Staining in human heart muscle and pancreas tissues using anti-PDHX antibody. Corresponding PDHX RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Oct‑3/4/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Alkaline phosphatase (ALPL) and Oct‑3/4 were detected in human BG01V embryonic stem cells using 10 µg/mL Human/Mouse/Rat ALPL Monoclonal Antibody (Catalog # MAB1448) and 10 µg/mL Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759). Cells were incubated with primary antibodies for 3 hours at room temperature. Cells were stained for ALPL using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (pseudo-stained green; Catalog # NL007), and stained for Oct-3/4 using the NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL002). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of BG01V human embryonic stem cells and NTera‑2 human testicular embryonic carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Oct‑3/4 at approximately 50 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(36 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
HNF-3 beta/FoxA2
Antibody (7E6)
H00003170-M01
HNF-3 beta/FoxA2 Antibody (7E6)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, KD

Publications for HNF-3 beta/FoxA2 Antibody (H00003170-M01)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M01) (0)

There are no reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HNF-3 beta/FoxA2 Antibody (H00003170-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HNF-3 beta/FoxA2 Products

Bioinformatics Tool for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

Discover related pathways, diseases and genes to HNF-3 beta/FoxA2 Antibody (H00003170-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

Discover more about diseases related to HNF-3 beta/FoxA2 Antibody (H00003170-M01).
 

Pathways for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

View related products by pathway.

PTMs for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

Learn more about PTMs related to HNF-3 beta/FoxA2 Antibody (H00003170-M01).

Blogs on HNF-3 beta/FoxA2

There are no specific blogs for HNF-3 beta/FoxA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HNF-3 beta/FoxA2 Antibody (7E6) and receive a gift card or discount.


Bioinformatics

Gene Symbol FOXA2
Entrez
OMIM
Uniprot