HNF-3 beta/FoxA2 Antibody (7E6)

Images

 
Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody (M01), clone 7E6.Lane 1: FOXA2 transfected lysate(48.3 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of monoclonal antibody to FOXA2 on HepG2 cell. Antibody concentration 10 ug/ml.
Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi ( Cat # H00003170-R01V ) (Lane 2) or non-transfected ...read more
Western Blot: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - FOXA2 monoclonal antibody (M01), clone 7E6 Analysis of FOXA2 expression in HepG2.
Immunoprecipitation: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Analysis of FOXA2 transfected lysate using anti-FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 MaxPab rabbit ...read more
ELISA: HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - HNF-3 beta/FoxA2 Antibody (7E6) [H00003170-M01] - Detection limit for recombinant GST tagged FOXA2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, KD
Clone
7E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HNF-3 beta/FoxA2 Antibody (7E6) Summary

Immunogen
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Specificity
FOXA2 - forkhead box A2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.
Publications
Read Publications using
H00003170-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HNF-3 beta/FoxA2 Antibody (7E6)

  • forkhead box A2
  • Forkhead box protein A2
  • FoxA2
  • hepatic nuclear factor-3-beta
  • hepatocyte nuclear factor 3, beta
  • hepatocyte nuclear factor 3-beta
  • HNF3 beta
  • HNF-3 beta
  • HNF-3B
  • HNF-3-beta
  • HNF3BTCF-3B
  • MGC19807
  • TCF3B
  • Transcription factor 3B

Background

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-87461
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NBP2-27079
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
1845-SH/CF
Species: Hu
Applications: BA
NBP1-84671
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2419
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
AF1924
Species: Hu
Applications: ChIP, ICC, Simple Western, WB
NBP2-52575
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF4186
Species: Hu
Applications: ICC, WB
NBP1-84079
Species: Hu
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
H00003170-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, KD

Publications for HNF-3 beta/FoxA2 Antibody (H00003170-M01)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M01) (0)

There are no reviews for HNF-3 beta/FoxA2 Antibody (H00003170-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HNF-3 beta/FoxA2 Antibody (H00003170-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HNF-3 beta/FoxA2 Products

Bioinformatics Tool for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

Discover related pathways, diseases and genes to HNF-3 beta/FoxA2 Antibody (H00003170-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

Discover more about diseases related to HNF-3 beta/FoxA2 Antibody (H00003170-M01).
 

Pathways for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

View related products by pathway.

PTMs for HNF-3 beta/FoxA2 Antibody (H00003170-M01)

Learn more about PTMs related to HNF-3 beta/FoxA2 Antibody (H00003170-M01).

Blogs on HNF-3 beta/FoxA2

There are no specific blogs for HNF-3 beta/FoxA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HNF-3 beta/FoxA2 Antibody (7E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXA2
Entrez
OMIM
Uniprot