HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free

Western Blot: HNF-3 beta/FoxA2 Antibody (6C12) [H00003170-M12] - Analysis of FOXA2 expression in K-562 (Cat # L009V1).

Immunocytochemistry/Immunofluorescence: HNF-3 beta/FoxA2 Antibody (6C12) [H00003170-M12] - Analysis of monoclonal antibody to FOXA2 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: HNF-3 beta/FoxA2 Antibody (6C12) [H00003170-M12] - Analysis of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 0.5 ug/ml

ELISA: HNF-3 beta/FoxA2 Antibody (6C12) [H00003170-M12] - Detection limit for recombinant GST tagged FOXA2 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Flow, ICC/IF, IHC
• Clone: 6C12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
• Specificity: forkhead box A2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FOXA2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Flow Cytometry
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
• Application Notes: Use in Flow Cytometry reported in scientific literature (PMID:34280890). Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HNF-3 beta/FoxA2 Antibody (6C12) - Azide and BSA Free

• forkhead box A2
• Forkhead box protein A2
• FoxA2
• hepatic nuclear factor-3-beta
• hepatocyte nuclear factor 3, beta
• hepatocyte nuclear factor 3-beta
• HNF3 beta
• HNF-3 beta
• HNF-3B
• HNF-3-beta
• HNF3BTCF-3B
• MGC19807
• TCF3B
• Transcription factor 3B

Background

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HNF-3 beta/FoxA2 Antibody (H00003170-M12)(16)

Publications using H00003170-M12

• Sabir, MS;Leoyklang, P;Hackbarth, ME;Pak, E;Dutra, A;Tait, R;Pollard, L;Adams, DR;Gahl, WA;Huizing, M;Malicdan, MCV; Generation and characterization of two iPSC lines derived from subjects with Free Sialic Acid Storage Disorder (FSASD) Stem cell research 2024-10-22 [PMID: 39461116]
• Yan H, Yang X, Jiachen Z et al. An artificial LAMA2-GelMA hydrogel microenvironment for the development of pancreatic endocrine progenitors. Biomaterials. 2022-10-31 [PMID: 36334352]
• Kim JH, Hong JH, Kang KW et al. Generation of the human pluripotent stem cell lines KUMi005-A from a patients with multiple myeloma Stem Cell Research 2022-12-01 [PMID: 36332466] (ICC/IF, Human)
• JH Kim, KW Kang, BH Lee, Y Park, BS Kim Generation of human induced iPSC KUMi003-A from acute promyelocytic leukemia (APL) M3 Oncogene, 2022-07-09;63(0):102861. 2022-07-09 [PMID: 35905670]
• Kim Jh, Kang Kw, Lee Bh Et Al. Generation of induced pluripotent stem cell line KUMi002-A with normal karyotype from a patient with Philadelphia chromosome-positive chronic myeloid leukemia Stem cell research 2021-07-12 [PMID: 34303284]
• Kim Jh, Kang Kw, Lee Bh Et Al. GeneRation of the induced pluripotent stem cell line KUMi001-A carrying the Philadelphia chromosome from a chronic myeloid leukemia patient Stem cell research 2021-07-12 [PMID: 34280890] (ICC/IF, FLOW)
• Amanda Y, Jane W, Beverly K et al. An iPSC line derived from a human acute myeloid leukemia cell line (HL-60-iPSC) retains leukemic abnormalities and displays myeloid differentiation defects. Stem Cell Res. 2020-11-23 [PMID: 33370871]
• Lee S, Kim J, Kang K et al. Generation of normal induced pluripotent stem cell line KUMCi002-A from bone marrow CD34+ cells of patient with multiple myeloma disease having 13q deletion and IGH translocation Stem Cell Research 2020-12-01 [PMID: 33142253] (ICC/IF, Human)
• Serra-Vinardell J, Sandler M, Pak E et al. Generation and characterization of four Chediak-Higashi Syndrome (CHS) induced pluripotent stem cell (iPSC) lines Stem Cell Research 2020-01-01 [PMID: 32619719] (ICC/IF, Human)
• Delaforest A, Quryshi Af, Frolkis Ts et Al. GATA4 Is Required for Budding Morphogenesis of Posterior Foregut Endoderm in a Model of Human Stomach Development Front Med (Lausanne) 2020-02-19 [PMID: 32140468] (IF, Human)
• Schill D, Nord J, Cirillo LA. FoxO1 and FoxA1/2 form a complex on DNA and cooperate to open chromatin at insulin regulated genes Biochem. Cell Biol. 2018-08-24 [PMID: 30142277] (WB, Human)
• Chua CW, Epsi NJ, Leung EY et al. Differential requirements of androgen receptor in luminal progenitors during prostate regeneration and tumor initiation. Elife 2018-01-15 [PMID: 29334357]
• Vanova T, Konecna Z, Zbonakova Z et al. Tyrosine Kinase Expressed in Hepatocellular Carcinoma, TEC, Controls Pluripotency and Early Cell Fate Decisions of Human Pluripotent Stem Cells via Regulation of Fibroblast Growth Factor-2 Secretion Stem Cells 2017-06-20 [PMID: 28631381] (Human)
• Noto FK, Determan MR, Cai J et al. Aneuploidy is permissive for hepatocyte-like cell differentiation from human induced pluripotent stem cells. BMC Res Notes 2014-07-22 [PMID: 25002137] (ICC/IF, Human)
  
  Details:
  FOXA2 antibody used for ICC-IF as endo-dermal marker during the in-vitro differentiation of human iPSC-K3-aneuploid cells to hepatocyte-like cells - fixed with 4% PFA 20 min RT, permeablized with 0.4% Triton X-100-PBS 15 min RT, blocked with 3% BSA -PBS 1 hour RT, incubated ON with primary diluted 1:1000 (Figure 2).
• Sourisseau M, Goldman O, He W et al. Hepatic Cells Derived from Induced Pluripotent Stem Cells of Pigtail Macaques Support Hepatitis C Virus infection. Gastroenterology 2013-07-24 [PMID: 23891978]
• Delaforest A, Nagaoka M, Si-Tayeb K et al. HNF4A is essential for specification of hepatic progenitors from human pluripotent stem cells. Development 138(19):4143-53. 2011-10-01 [PMID: 21852396]

FAQs for HNF-3 beta/FoxA2 Antibody (H00003170-M12). (Showing 1 - 1 of 1 FAQs).

1. I want to use the FoxA2 antibody (H00003170-M12) for Immunohistochemistry-Paraffin. Therefore I'm wondering if you can tell me which protocol you used to generate your picture? Which dilution did you take and which antigen retrieval method did you use in this case?
   • Here is the link to the protocol that Abnova (the company that produces this antibody) uses on their site listed under the product (http://www.abnova.com/protocol_pdf/Immunohistochemistry.pdf). The dilution is 0.5 ug/mL. I would recommend citrate buffer pH 6.0 as the antigen retrieval as that is the one our lab has a lot of success with. We use a pressure cooker for the citrate buffer antigen retrieval method.

Bioinformatics

• Gene Symbol: FOXA2
• Entrez:
  • 3170(Human)
• OMIM:
  • 600288(Human)
• Uniprot:
  • NP_068556(Human)