HMG2L1 Antibody (3C12)

Images

 
Immunocytochemistry/ Immunofluorescence: HMG2L1 Antibody (3C12) [H00010042-M03] - Analysis of monoclonal antibody to HMGXB4 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: HMG2L1 Antibody (3C12) [H00010042-M03] - Analysis of monoclonal antibody to HMG2L1 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HMG2L1 Antibody (3C12) Summary

Immunogen
HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
Specificity
HMG2L1 (3C12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HMGXB4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for immunohistochemistry (paraffin).

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMG2L1 Antibody (3C12)

  • High mobility group protein 2-like 1
  • high-mobility group protein 2-like 1
  • HMG box domain containing 4
  • HMG domain-containing protein 4
  • HMG2L1HMG box-containing protein 4
  • HMGBCG
  • Protein HMGBCG
  • THC211630

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16774
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-86170
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
MAB4028
Species: Hu, Mu
Applications: WB
NBP2-80461
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00009146-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-38514
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
294-HG/CF
Species: Hu
Applications: BA
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-79778
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-32264
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46228
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00010042-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for HMG2L1 Antibody (H00010042-M03) (0)

There are no publications for HMG2L1 Antibody (H00010042-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMG2L1 Antibody (H00010042-M03) (0)

There are no reviews for HMG2L1 Antibody (H00010042-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HMG2L1 Antibody (H00010042-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMG2L1 Products

Bioinformatics Tool for HMG2L1 Antibody (H00010042-M03)

Discover related pathways, diseases and genes to HMG2L1 Antibody (H00010042-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HMG2L1

There are no specific blogs for HMG2L1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMG2L1 Antibody (3C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGXB4
Entrez
OMIM
Uniprot