HMG2L1 Antibody (3C12)

Immunocytochemistry/Immunofluorescence: HMG2L1 Antibody (3C12) [H00010042-M03] - Analysis of monoclonal antibody to HMGXB4 on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: HMG2L1 Antibody (3C12) [H00010042-M03] - Analysis of monoclonal antibody to HMG2L1 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3C12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

HMG2L1 Antibody (3C12) Summary

• Immunogen: HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
• Specificity: HMG2L1 (3C12)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HMGXB4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for immunohistochemistry (paraffin).

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMG2L1 Antibody (3C12)

• High mobility group protein 2-like 1
• high-mobility group protein 2-like 1
• HMG box domain containing 4
• HMG domain-containing protein 4
• HMG2L1HMG box-containing protein 4
• HMGBCG
• Protein HMGBCG
• THC211630

Background

Negatively regulates Wnt/beta-catenin signaling during development

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGXB4
• Entrez:
  • 10042(Human)
• OMIM:
  • 604702(Human)
• Uniprot:
  • NP_001003681(Human)