HMG2L1 Antibody (3B4) - Azide and BSA Free

Western Blot: HMG2L1 Antibody (3B4) [H00010042-M01] - Detection against Immunogen (33.88 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HMG2L1 Antibody (3B4) - Azide and BSA Free Summary

• Immunogen: HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
• Specificity: HMG2L1 - high-mobility group protein 2-like 1 (3B4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HMGXB4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMG2L1 Antibody (3B4) - Azide and BSA Free

• High mobility group protein 2-like 1
• high-mobility group protein 2-like 1
• HMG box domain containing 4
• HMG domain-containing protein 4
• HMG2L1HMG box-containing protein 4
• HMGBCG
• Protein HMGBCG
• THC211630

Background

Negatively regulates Wnt/beta-catenin signaling during development

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGXB4
• Entrez:
  • 10042(Human)
• Uniprot:
  • NP_001003681(Human)