HLF Recombinant Protein Antigen

Images

 
There are currently no images for HLF Recombinant Protein Antigen (NBP2-56606PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HLF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HLF.

Source: E. coli

Amino Acid Sequence: VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HLF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56606.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HLF Recombinant Protein Antigen

  • hepatic leukemia factor
  • MGC33822

Background

HLF encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to activate transcription. Chromosomal translocations fusing portions of this gene with the E2A gene cause a subset of childhood B-lineage acute lymphoid leukemias. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-84300
Species: Hu
Applications: IHC,  IHC-P, WB
MAB7650
Species: Mu
Applications: IHC, WB
NBP1-88027
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC,  IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2364
Species: Hu
Applications: IHC, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
DY4517-05
Species: Mu
Applications: ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB8570
Species: Hu
Applications: CyTOF-ready, Flow
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
AF6116
Species: Hu
Applications: ICC, WB

Publications for HLF Recombinant Protein Antigen (NBP2-56606PEP) (0)

There are no publications for HLF Recombinant Protein Antigen (NBP2-56606PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLF Recombinant Protein Antigen (NBP2-56606PEP) (0)

There are no reviews for HLF Recombinant Protein Antigen (NBP2-56606PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HLF Recombinant Protein Antigen (NBP2-56606PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLF Products

Array NBP2-56606PEP

Blogs on HLF

There are no specific blogs for HLF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HLF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HLF