HLA DRB1 Antibody (6Z1F10) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HLA DRB1 (P01911). ARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVY |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
HLA-DRB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HLA DRB1 Antibody (6Z1F10)
Background
HLA DRB1 can be used for HLA typing.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: Bind
Publications for HLA DRB1 Antibody (NBP3-15950) (0)
There are no publications for HLA DRB1 Antibody (NBP3-15950).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HLA DRB1 Antibody (NBP3-15950) (0)
There are no reviews for HLA DRB1 Antibody (NBP3-15950).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HLA DRB1 Antibody (NBP3-15950). (Showing 1 - 1 of 1 FAQ).
-
We are interested in custom labeling our antibodies to be able to integrate new markers into already existing multicolor FACS panels. We would be glad to receive pricing and general order information for anti-HLA-DRB1 and anti-HLA-DRB5. To estimate expenses for future antibody labeling orders it would be helpful to know on what basis (amount, type, etc.) the price is going to be calculated. Right now the antibodies are still in mouse ascites. Would it be possible to integrate the elution of the antibodies from the ascites before labeling as part of the service agreement?
- While we do not generally do this kind of custom purification unless it is for very large amounts of antibody, we do have a number of kits available that may be of use to you. Since an antibody that is still in ascites can not be labeled, it will need to be purified. A list of our kits available for this can be found at the following link: AbSelect. Once the antibodies are purified, they can be labeled with any number of different colors. A list of these kits for labeling can be found at the following link: Lightning-Link.
Secondary Antibodies
| |
Isotype Controls
|
Additional HLA DRB1 Products
Research Areas for HLA DRB1 Antibody (NBP3-15950)
Find related products by research area.
|
Blogs on HLA DRB1