HLA DOA Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HLA DOA Antibody [Unconjugated] - BSA Free (NBP3-43684) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HLA-DOA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HLA DOA Antibody - BSA Free
Background
HLA DOA, also known as HLA class II histocompatibility antigen DO alpha chain, is a 250 amino acid protein that is 28 kDa, found in lysosomes in B cells and controls HLA-DM-mediated peptide loading on MHC class II molecules. Current research is being done on several diseases and disorders including vogt-koyanagi-harada disease, alopecia universalis, alopecia, systemic lupus erythematosus, graft versus host disease, lupus erythematosus, rheumatoid arthritis, toxoplasmosis, autoimmune thyroiditis, leishmaniasis, myocarditis, diabetes mellitus, arthritis influenza, immunodeficiency, asthma, tuberculosis, thyroiditis, interferon, and hepatitis b. Interactions with the HLA DOA protein have shown to involve ENSG00000204252 and HLA-DMA proteins in immune response antigen presentation by MHC class II, G-protein signaling N-RAS regulation pathway, immune response IL-22 signaling pathway, immune response NFAT in immune response, immune response ICOS pathway in T-helper cell, phagosome, cell adhesion molecules (CAMs), antigen processing and presentation, intestinal immune network for IgA production,and type I diabetes mellitus pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Publications for HLA DOA Antibody (NBP3-43684) (0)
There are no publications for HLA DOA Antibody (NBP3-43684).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HLA DOA Antibody (NBP3-43684) (0)
There are no reviews for HLA DOA Antibody (NBP3-43684).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for HLA DOA Antibody (NBP3-43684) (0)