We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human HLA A GST (N-Term) Protein

Images

 
SDS-Page: HLA A Recombinant Protein [H00003105-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related HLA A Peptides and Proteins

Order Details


    • Catalog Number
      H00003105-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HLA A GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-342 of Human HLA-A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HLA-A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • In vitro assay
  • Protein Array
  • Western Blot
Theoretical MW
63.36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
H00003105-P01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HLA A GST (N-Term) Protein

  • A-10 alpha chain
  • FLJ26655
  • HLA class I histocompatibility antigen, A-1 alpha chain
  • HLA class I histocompatibility antigen, A-28 alpha chain
  • HLA class I histocompatibility antigen, A-9 alpha chain
  • HLAA
  • major histocompatibility complex, class I, A
  • MHC class I antigen A*1
  • MHC class I antigen A*11
  • MHC class I antigen A*80

Background

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
NBP3-22412
Species: Hu
Applications: Flow, IHC, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14093
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-35275
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
485-MI
Species: Mu
Applications: BA
202-IL
Species: Hu
Applications: BA
NB500-314
Species: Hu, Mu(-)
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for HLA A Recombinant Protein (H00003105-P01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: In vitro, WB.


Filter By Application
In vitro
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HLA A Recombinant Protein (H00003105-P01) (0)

There are no reviews for HLA A Recombinant Protein (H00003105-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA A Recombinant Protein (H00003105-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA A Products

Research Areas for HLA A Recombinant Protein (H00003105-P01)

Find related products by research area.

Blogs on HLA A

There are no specific blogs for HLA A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HLA A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-A