HKR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HKR1 Antibody [NBP1-86826] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: HKR1 Antibody [NBP1-86826] - Staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HKR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YPEDQKQQQDPFCFSGKAEWIQEGEDSRLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HKR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HKR1 Protein (NBP1-86826PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HKR1 Antibody

  • GLI-Kruppel family member HKR1
  • HKR1, GLI-Kruppel zinc finger family member
  • Krueppel-related zinc finger protein 1
  • Protein HKR1
  • Zinc finger protein 875
  • ZNF875oncogene HKR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20774
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87055
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-79358
Species: Hu
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HKR1 Antibody (NBP1-86826) (0)

There are no publications for HKR1 Antibody (NBP1-86826).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HKR1 Antibody (NBP1-86826) (0)

There are no reviews for HKR1 Antibody (NBP1-86826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HKR1 Antibody (NBP1-86826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HKR1 Products

Bioinformatics Tool for HKR1 Antibody (NBP1-86826)

Discover related pathways, diseases and genes to HKR1 Antibody (NBP1-86826). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HKR1 Antibody (NBP1-86826)

Discover more about diseases related to HKR1 Antibody (NBP1-86826).
 

Pathways for HKR1 Antibody (NBP1-86826)

View related products by pathway.

PTMs for HKR1 Antibody (NBP1-86826)

Learn more about PTMs related to HKR1 Antibody (NBP1-86826).

Blogs on HKR1

There are no specific blogs for HKR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HKR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HKR1