Recombinant Human Histone H4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Histone H4 Peptides and Proteins

Order Details


    • Catalog Number
      H00121504-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Histone H4 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-103 of Human HIST4H4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
H4C16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.07 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Histone H4 GST (N-Term) Protein

  • H4
  • H4/A
  • H4/B
  • H4/C
  • H4/D
  • H4/E
  • H4/G
  • H4/H
  • H4/I
  • H4/J
  • H4/K
  • H4/M
  • H4/N
  • H4/O
  • H4/p
  • H4F2
  • H4FA
  • H4FB
  • H4FC
  • H4FD
  • H4FE
  • H4FG
  • H4FH
  • H4FI
  • H4FJ
  • H4FK
  • H4FM
  • H4FN
  • H4FO
  • H4M
  • HIST1H4A
  • HIST1H4B
  • HIST1H4C
  • HIST1H4D
  • HIST1H4E
  • HIST1H4F
  • HIST1H4H
  • HIST1H4I
  • HIST1H4J
  • HIST1H4K
  • HIST1H4L
  • HIST2H4
  • HIST2H4A
  • HIST2H4B
  • HIST4H4
  • histone 4, H4
  • Histone Cluster 1 H4
  • Histone Cluster 1 H4i
  • Histone Cluster 4 H4
  • histone cluster 4, H4
  • Histone H4
  • MGC24116

Background

HIST4H4( AAH20884, 1 a.a. - 104 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP3-46115
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
2695-SE
Species: Hu
Applications: EnzAct
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-55251
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-24613
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-46085
Species: Hu
Applications: IHC, IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Histone H4 Recombinant Protein (H00121504-P01) (0)

There are no publications for Histone H4 Recombinant Protein (H00121504-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H4 Recombinant Protein (H00121504-P01) (0)

There are no reviews for Histone H4 Recombinant Protein (H00121504-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histone H4 Recombinant Protein (H00121504-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Histone H4 Products

Research Areas for Histone H4 Recombinant Protein (H00121504-P01)

Find related products by research area.

Blogs on Histone H4.

H4 - Monitoring global chromatin structure through histone modifications
Histones make up the main protein component of chromatin and are responsible for storing and organizing the genome in a compact yet accessible manner. In addition to storage, histones play an important role in the regulation of various cellular pro...  Read full blog post.

Histone H4 Phosphorylation: Affecting Liver Regeneration and Cancer
Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t...  Read full blog post.

Histone H4: Implications in Liver Cancer
Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t...  Read full blog post.

"Come Fly with Me" - New Drosophila Model Developed for Direct in Vivo Study of Histones
Forming the major protein component of chromatin, histones are essential to the structure and organization of chromosomes, forming the nucleosome around which DNA is packaged and wrapped.Antibody studies have revealed histones undergo various posttr...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Histone H4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H4C16