![Western Blot: Histone H2AX Antibody [NBP3-04113] - Analysis of extracts of various cell lines, using Histone H2Ax antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Histone-H2AX-Antibody-Western-Blot-NBP3-04113-img0003.jpg "Western Blot: Histone H2AX Antibody [NBP3-04113] - Analysis of extracts of various cell lines, using Histone H2Ax antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Histone H2AX Antibody - BSA Free (NBP3-04113) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX (NP_002096.1). MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | H2AX |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 15 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Histone H2AX Antibody (NBP3-04113)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | H2AX |
![Immunocytochemistry/ Immunofluorescence: Histone H2AX Antibody - BSA Free [Histone H2AX] - Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-04113_rabbit-polyclonal-histone-h2ax-antibody-52202516345216.jpg "Immunocytochemistry/ Immunofluorescence: Histone H2AX Antibody - BSA Free [Histone H2AX] - Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-04113_rabbit-polyclonal-histone-h2ax-antibody-5220251633415.jpg "Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-04113_rabbit-polyclonal-histone-h2ax-antibody-52202516321423.jpg "Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-04113_rabbit-polyclonal-histone-h2ax-antibody-52202516345242.jpg "Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Western Blot: Histone H2AX Antibody - BSA Free [Histone H2AX] - Western blot analysis of various lysates using Histone H2AX Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-04113_rabbit-polyclonal-histone-h2ax-antibody-52202516334117.jpg "Western Blot: Histone H2AX Antibody - BSA Free [Histone H2AX] - Western blot analysis of various lysates using Histone H2AX Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.")
![Western Blot DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Western_Blot_16723.jpg)
![Simple Western DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_17635.jpg)
![Immunohistochemistry DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_7152.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")