| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HRH2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P reported in scientific literature (PMID: 26907350). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-86082 | Applications | Species |
|---|---|---|
| Tanaka T, Kochi T, Shirakami Y et al. Cimetidine and Clobenpropit Attenuate Inflammation-Associated Colorectal Carcinogenesis in Male ICR Mice Cancers (Basel) 2016-02-24 [PMID: 26907350] (IHC-P, Mouse) | IHC-P | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ICC | Human | 06/05/2018 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Mozhdeh Sojoodi |
IHC-P | Rat | 05/04/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Histamine H2R Antibody (NBP1-86082)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 06/05/2018 |
||
| Application: | ICC | |
| Species: | Human |
| Mozhdeh Sojoodi 05/04/2018 |
||
| Application: | IHC-P | |
| Species: | Rat |
| Gene Symbol | HRH2 |