HGK/MAP4K4 Antibody (4A5)

Images

 
Western Blot: HGK/MAP4K4 Antibody (4A5) [H00009448-M07] - Analysis of MAP4K4 expression in K-562 (Cat # L009V1).
Immunohistochemistry-Paraffin: HGK/MAP4K4 Antibody (4A5) [H00009448-M07] - Analysis of monoclonal antibody to MAP4K4 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
ELISA: HGK/MAP4K4 Antibody (4A5) [H00009448-M07] - Detection limit for recombinant GST tagged MAP4K4 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Bv, PaSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
4A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HGK/MAP4K4 Antibody (4A5) Summary

Immunogen
MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
Specificity
MAP4K4 - mitogen-activated protein kinase kinase kinase kinase 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP4K4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Control
HGK/MAP4K4 Knockout HeLa Cell Lysate
Publications
Read Publications using H00009448-M07.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HGK/MAP4K4 Antibody (4A5)

  • EC 2.7.11
  • EC 2.7.11.1
  • FLH21957
  • FLJ10410
  • hepatocyte progenitor kinase-like/germinal center kinase-like kinase
  • HGK
  • HGKFLJ20373
  • HPK/GCK-like kinase HGK
  • KIAA0687
  • MAP4K4
  • MAPK/ERK kinase kinase kinase 4
  • MEK kinase kinase 4
  • MEKKK 4
  • MEKKK4
  • mitogen-activated protein kinase kinase kinase kinase 4
  • Nck-interacting kinase
  • NIKFLJ90111

Background

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56144
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP1-76800
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
MAB3468
Species: Hu
Applications: WB, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00009448-M07
Species: Hu, Bv, Pa
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for HGK/MAP4K4 Antibody (H00009448-M07)(2)

Reviews for HGK/MAP4K4 Antibody (H00009448-M07) (0)

There are no reviews for HGK/MAP4K4 Antibody (H00009448-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HGK/MAP4K4 Antibody (H00009448-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HGK/MAP4K4 Products

Bioinformatics Tool for HGK/MAP4K4 Antibody (H00009448-M07)

Discover related pathways, diseases and genes to HGK/MAP4K4 Antibody (H00009448-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGK/MAP4K4 Antibody (H00009448-M07)

Discover more about diseases related to HGK/MAP4K4 Antibody (H00009448-M07).
 

Pathways for HGK/MAP4K4 Antibody (H00009448-M07)

View related products by pathway.

PTMs for HGK/MAP4K4 Antibody (H00009448-M07)

Learn more about PTMs related to HGK/MAP4K4 Antibody (H00009448-M07).
 

Research Areas for HGK/MAP4K4 Antibody (H00009448-M07)

Find related products by research area.

Blogs on HGK/MAP4K4

There are no specific blogs for HGK/MAP4K4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGK/MAP4K4 Antibody (4A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K4
Entrez
OMIM
Uniprot