HERC6 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HERC6. Source: E. coli
Amino Acid Sequence: GQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDLVDVQVKHIFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSM Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HERC6 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83639. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HERC6 Recombinant Protein Antigen
Background
The HERC6 gene encodes a E3 ubiquitin-protein ligase that accepts ubiquitin from an E2 ubiquitin-conjugating enzyme. The HECT domain is expected to stimulate the formation of a thioester with ubiquitin before transmitting it to a substrate. The protein exists in three isoforms: isoform 1 is 1,022 amino acids long at a mass of 115 kDA, isoform 2 is 986 kDA at 111 kDA, and isoform 3 is 306 amino acids long at 32 kDA. HERC6 interacts with genes NME2, HERC3, HERC4, UBQLN2, and NME1-NME2. HERC6 has been investigated regarding its role in angelman syndrome, meningitis, and malaria.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Xp
Applications: ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: AC
Publications for HERC6 Protein (NBP1-83639PEP) (0)
There are no publications for HERC6 Protein (NBP1-83639PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HERC6 Protein (NBP1-83639PEP) (0)
There are no reviews for HERC6 Protein (NBP1-83639PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HERC6 Protein (NBP1-83639PEP) (0)
Additional HERC6 Products
Blogs on HERC6