HERC6 Antibody

Immunocytochemistry/Immunofluorescence: HERC6 Antibody [NBP1-83639] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.

Immunohistochemistry-Paraffin: HERC6 Antibody [NBP1-83639] - Staining of human tonsil shows distinct positivity in a subset of inflammatory cells.

Product Discontinued

HERC6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDLVDVQVKHIFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HERC6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HERC6 Antibody

• EC 6.3.2
• EC 6.3.2.-
• FLJ20637
• HECT domain and RCC1-like domain-containing protein 6
• hect domain and RLD 6
• potential ubiquitin ligase
• probable E3 ubiquitin-protein ligase HERC6

Background

The HERC6 gene encodes a E3 ubiquitin-protein ligase that accepts ubiquitin from an E2 ubiquitin-conjugating enzyme. The HECT domain is expected to stimulate the formation of a thioester with ubiquitin before transmitting it to a substrate. The protein exists in three isoforms: isoform 1 is 1,022 amino acids long at a mass of 115 kDA, isoform 2 is 986 kDA at 111 kDA, and isoform 3 is 306 amino acids long at 32 kDA. HERC6 interacts with genes NME2, HERC3, HERC4, UBQLN2, and NME1-NME2. HERC6 has been investigated regarding its role in angelman syndrome, meningitis, and malaria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HERC6