HERC6 Antibody


Immunocytochemistry/ Immunofluorescence: HERC6 Antibody [NBP1-83639] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: HERC6 Antibody [NBP1-83639] - Staining of human tonsil shows distinct positivity in a subset of inflammatory cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

HERC6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDLVDVQVKHIFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSM
Specificity of human HERC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HERC6 Protein (NBP1-83639PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HERC6 Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ20637
  • HECT domain and RCC1-like domain-containing protein 6
  • hect domain and RLD 6
  • potential ubiquitin ligase
  • probable E3 ubiquitin-protein ligase HERC6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HERC6 Antibody (NBP1-83639) (0)

There are no publications for HERC6 Antibody (NBP1-83639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERC6 Antibody (NBP1-83639) (0)

There are no reviews for HERC6 Antibody (NBP1-83639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HERC6 Antibody (NBP1-83639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HERC6 Products

Bioinformatics Tool for HERC6 Antibody (NBP1-83639)

Discover related pathways, diseases and genes to HERC6 Antibody (NBP1-83639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERC6 Antibody (NBP1-83639)

Discover more about diseases related to HERC6 Antibody (NBP1-83639).

Pathways for HERC6 Antibody (NBP1-83639)

View related products by pathway.

PTMs for HERC6 Antibody (NBP1-83639)

Learn more about PTMs related to HERC6 Antibody (NBP1-83639).

Blogs on HERC6

There are no specific blogs for HERC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HERC6 Antibody and receive a gift card or discount.


Gene Symbol HERC6