HERC4 Antibody

Images

 
Western Blot: HERC4 Antibody [NBP1-53020] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HERC4 Antibody Summary

Immunogen
Synthetic peptides corresponding to HERC4(hect domain and RLD 4) The peptide sequence was selected from the n terminal of HERC4. Peptide sequence MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HERC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HERC4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HERC4 Antibody

  • DKFZP564G092
  • EC 6.3.2
  • EC 6.3.2.-
  • HECT domain and RCC1-like domain-containing protein 4
  • hect domain and RLD 4
  • KIAA1593probable E3 ubiquitin-protein ligase HERC4

Background

HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-56484
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
AF7034
Species: Hu
Applications: WB
NBP2-13602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00051154-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
24340002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83083
Species: Hu
Applications: IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-59068
Species: Hu
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-53020
Species: Hu
Applications: WB

Publications for HERC4 Antibody (NBP1-53020) (0)

There are no publications for HERC4 Antibody (NBP1-53020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERC4 Antibody (NBP1-53020) (0)

There are no reviews for HERC4 Antibody (NBP1-53020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HERC4 Antibody (NBP1-53020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HERC4 Products

Bioinformatics Tool for HERC4 Antibody (NBP1-53020)

Discover related pathways, diseases and genes to HERC4 Antibody (NBP1-53020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERC4 Antibody (NBP1-53020)

Discover more about diseases related to HERC4 Antibody (NBP1-53020).
 

Pathways for HERC4 Antibody (NBP1-53020)

View related products by pathway.

PTMs for HERC4 Antibody (NBP1-53020)

Learn more about PTMs related to HERC4 Antibody (NBP1-53020).

Blogs on HERC4

There are no specific blogs for HERC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HERC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HERC4
Uniprot