HERC1 Antibody

Images

 
Immunohistochemistry-Paraffin: HERC1 Antibody [NBP2-14088] Staining of human lymph node shows strong cytoplasmic positivity in a subset of non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HERC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGKLLSSQEGMISFDCFMTILMQMRRSLGSSADRSQWREPTRTSDGLCSL YEAALCLFEEVCRMASDYSRTCASPDSIQTGDAPIVSETCEVYVWGSNSS HQLVEGTQEKILQPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HERC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HERC1 Protein (NBP2-14088PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HERC1 Antibody

  • EC 6.3.2
  • guanine nucleotide exchange factor p532
  • hect (homologous to the E6-AP (UBE3A) carboxyl terminus) domain and RCC1(CHC1)-like domain (RLD) 1
  • hect domain and RCC1-like domain 1
  • HECT domain and RCC1-like domain-containing protein 1
  • p532probable E3 ubiquitin-protein ligase HERC1
  • p619EC 6.3.2.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37922
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-46234
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for HERC1 Antibody (NBP2-14088) (0)

There are no publications for HERC1 Antibody (NBP2-14088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERC1 Antibody (NBP2-14088) (0)

There are no reviews for HERC1 Antibody (NBP2-14088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HERC1 Antibody (NBP2-14088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HERC1 Products

HERC1 NBP2-14088

Bioinformatics Tool for HERC1 Antibody (NBP2-14088)

Discover related pathways, diseases and genes to HERC1 Antibody (NBP2-14088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERC1 Antibody (NBP2-14088)

Discover more about diseases related to HERC1 Antibody (NBP2-14088).
 

Pathways for HERC1 Antibody (NBP2-14088)

View related products by pathway.

PTMs for HERC1 Antibody (NBP2-14088)

Learn more about PTMs related to HERC1 Antibody (NBP2-14088).

Blogs on HERC1

There are no specific blogs for HERC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HERC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HERC1