Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody

Images

 
Western Blot: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane ...read more
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human cerebral cortex shows granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLH
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HS2ST1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Protein (NBP1-91982PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody

  • 2OST
  • 2-O-sulfotransferase
  • EC 2.8.2
  • EC 2.8.2.-
  • FLJ11317
  • heparan sulfate 2-O-sulfotransferase 1
  • HS2ST
  • HS2ST1
  • KIAA0448dJ604K5.2
  • MGC131986

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF5057
Species: Hu
Applications: WB
233-FB/CF
Species: Hu
Applications: BA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
345-FG/CF
Species: Hu
Applications: BA
294-HG/CF
Species: Hu
Applications: BA
NBP2-31985
Species: Eq, Hu
Applications: ICC/IF, IHC, IHC-P
AF6585
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
H00003340-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP1-91875
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-32585
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-35009
Species: Hu
Applications: Func, PAGE, WB
6829-F6/CF
Species: Hu
Applications: BA
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
5444-SL
Species: Mu
Applications: BA
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
212-GD/CF
Species: Hu
Applications: Bind, BA

Publications for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982) (0)

There are no publications for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982) (0)

There are no reviews for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Products

Bioinformatics Tool for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982)

Discover related pathways, diseases and genes to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982)

Discover more about diseases related to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982).
 

Pathways for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982)

View related products by pathway.

PTMs for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982)

Learn more about PTMs related to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (NBP1-91982).

Blogs on Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1

There are no specific blogs for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HS2ST1